SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a021599m|PACid:17679099 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a021599m|PACid:17679099
Domain Number 1 Region: 78-469
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.45e-106
Family Motor proteins 0.00000105
Further Details:      
 
Weak hits

Sequence:  mgv1a021599m|PACid:17679099
Domain Number - Region: 485-550
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0102
Family Myosin rod fragments 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) mgv1a021599m|PACid:17679099
Sequence length 782
Sequence
HIEENSDIVDISGASDDTRETSIYQGQTLPIFLKIQDLSNKVQVMRKEHARLCDEVKGMT
ADSLIGSEALTALQNLSAEYENLKNKYNEECDLLKKKYLEECSERKKLYNEVIELKGNIR
VFCRCRPMKQDEIAKGSTSVVDFDSSQENELQIISSDSSKKQFKFDHVFKPEDNQEDVFV
QTLPIVTSVLDGYNVCIFAYGQTGTGKTYTMEGTPDNRGVNYRTLEELFRISKERSGIMR
YELLVSMLEVYNEKIRDLLVDNSNQPAKKLEIKQSAEGTQEVPGLVEARVYGIDEVWALL
KSGSQARSVGSTNANELSSRSHCLLRVSVVGENLINGQRARSHLWLVDLAGSERVGRIEV
EGERLKESQFINKSLSALGDVIAALASKTSHVILWTNRNSKLTHMLQSSLGELLDFAIDS
MTLHINNIKWKFNAGGDCKTLMFVQISPNMTDFGETLCSLNFASRVRGVEHGPARKQTDH
AELFKYKQLAEKAKQDEKETKKLQDNMQALQLRLAAREHICRNLQEKVRDLENQLAEERK
TRLKQENRALASISTQSALSTTSNQTATQKVATDNKKPPLAPSKLRPPLRRITNFMPVQP
SAAATSNKKNMSFLPVVNEELKENNNSNRGKQPMILKPRRGSIAVRPTQAAQQTGQVFQP
KRRASIATFHTESSMKTPLGRPKNDRVMGRQSFVWDPQRVWRTSRVSSPLPQPREVSLYA
TTVETTPIGHRSSKFRGSPPSQQPGSWKPKHPTVIALQKKHLVWSPLKLKGMKNKRSSLL
PS
Download sequence
Identical sequences A0A022R2H5
mgv1a021599m|PACid:17679099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]