SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a022223m|PACid:17694497 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv1a022223m|PACid:17694497
Domain Number - Region: 69-172
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000811
Family Myosin rod fragments 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) mgv1a022223m|PACid:17694497
Sequence length 359
Sequence
LVPLLLSPHIDREDDFGGDFARGNTAGRQGVKRNFGVIDDEDDDIFGSKKANLKVEETAP
GMTTGMILSLRESLKNCQDELSNCQTKLEDAKSEIQKWRSSFQNESFVPQSTTPEPRFVV
SYLQTLRSSEESLREQLEKAKKKEAAFIVTFAKREQEIAELKSAVRDLRAQLKPPSMQAR
RLLLDPAIHEEFTRLKNLVEEKDKKVKELQDNINAVSFTSQSKMGKMIMAKCRTLQEENE
EIGNQANEGKIHELGMKLALQKSQNAELRSQFEGLFKQMDKLTSDVDRSNELAVIMQEKL
EEKENEIQRLKHGMEKNSVVEEEQTTVLATDIVDGGDDDANVDGVTPIKVKIESESQLD
Download sequence
Identical sequences A0A022RFJ5
mgv1a022223m|PACid:17694497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]