SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a023838m|PACid:17678430 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv1a023838m|PACid:17678430
Domain Number - Region: 99-252
Classification Level Classification E-value
Superfamily Tropomyosin 0.00981
Family Tropomyosin 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) mgv1a023838m|PACid:17678430
Sequence length 277
Sequence
MQTPKARTSPAGGGAAQRISPRSSSTEVTQKNSPSQGGGGGSAEVSQKSSPKVVRQLKTG
PRFLDHTASSSNLATKAPKERSPKLADHRSPKSPISEKKRQSRVSELENQISKLERDLQT
VKDQLCSTEELKKQAQKEAEESNQQLSALSLKLEESRKLLENSGPEEISEERDPILVSEL
DAIQKQHSHDTAALASALDEIKQLKNQLETVSESESAHFKNSELDKNELEDLKKSLSETL
SLVEEMKNELSDCKESETRAHALVGETLTQLETAKKK
Download sequence
Identical sequences A0A022RB92
mgv1a023838m|PACid:17678430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]