SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a023977m|PACid:17686168 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv1a023977m|PACid:17686168
Domain Number - Region: 497-578
Classification Level Classification E-value
Superfamily Tropomyosin 0.0085
Family Tropomyosin 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) mgv1a023977m|PACid:17686168
Sequence length 597
Sequence
SPKSVVGSPSSVDSPATAAARVVESPLGNTTTGSPKLDVGEIDTRAPFESVKAAVSLFGE
VISPRARPITKKTKAEEQKLLEKETQHHMILRELDYYKDQLRTTQTAKSQALRDLQKANR
TLQELTNKLEALSESKQAAIKATEAAKTRAHDLEKQKSIKAQLGSDAWKLDLDTERERYK
ASSGELIASKQELTNLRQDFDAALEAKLLAFQETEDAKQATKTNLERESQLSREVKMLRE
TLDQVKIASLQAQEEHLKLIAEKEVHVLVHKSAREVAETEINRYKEENGAGENLKEKLEE
TTEAIKVLQEQLNDVRASDFSSLKKVLLELDCARTELREIVAEEVSIRSFVDSIQLQLEE
VKRKHYECNNKVLEAEALVKQMEADLTDRKTELNEARSRNVLEDMKSALENLLEEAAKNK
QETEEIKKEIDLVKQEAAAAAFAAKEADKKLETALKEAEAAKVAEKLADDQIHDSPRNDA
IDSKGPGSSRRIRLTVEEFKSMNQKIEECRKKADLEVATLISHVQSLNASENEVLQKVEG
ILKENENIQSEIEDALKRAEMAEAAKKVVEGELQKWRTKEDNTEIGEPSYISEEKLQ
Download sequence
Identical sequences A0A022R2J4
mgv1a023977m|PACid:17686168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]