SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a024103m|PACid:17690268 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv1a024103m|PACid:17690268
Domain Number - Region: 21-112
Classification Level Classification E-value
Superfamily Tropomyosin 0.0464
Family Tropomyosin 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) mgv1a024103m|PACid:17690268
Sequence length 314
Sequence
MQKLTALKKAYADVILSTSKEAAARVLSSERKSARWQHELAAAKEDGVRMLMRLKKMMDS
QMSEAEAASLAKQKKIEELEAQLEEAEDIVSDLRQELGQAHAELDRVKNENLRRANERIF
LPPNGSSDVGKDRNGFTHRIRACERKVLEADVAKDASKAPPAADMKIGRFQSFVIKRKRA
ARRRRTIVPSIAILTEGNSPSDENPLKDEASIEKTMPLEISNEASESLCSPDYKMESIKE
ICDEPPRGRAFKYTFQRKRKRQALSEIEAKGSLEEEEEKTGDGKNGDQNLEQSNPSLLTE
SSRESRRLAQVARQ
Download sequence
Identical sequences A0A022QFX0
mgv1a024103m|PACid:17690268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]