SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a024420m|PACid:17679139 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv1a024420m|PACid:17679139
Domain Number - Region: 523-622
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0131
Family Myosin rod fragments 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) mgv1a024420m|PACid:17679139
Sequence length 671
Sequence
GDGNNRKDPVVVDLIEEFNNHYQSLYASYENLTEELRKKAHGYHKNSSSSSSSDSSDSDE
SSNKKGKKNGKVKINFETDTAVVKQELEMALLEVGDLKRKLAATEDEKEALYLEYQAEGE
KSNEEKSKLLAENAEINIELGSLRKVQAELNQRLEDVEKERESLIADKEAVFFNAEELRT
INSELQHEKKNLHLELESVNGLLSTLKQDYESLKNEVVKLSQMQKTAEEENFKFSSKISH
LENEIELAENKNRDLVTESRRLSEELAEKEIELSRHLEIHEAYKEEASARIKDLELQILH
KENEASTKIEDLVDQINAKDKELEDQMSSKITEVNQLREEKCGLENKISELEKSLAEKRD
DFVAIEKEMEEVRSNASIQIAALTEQVKSSENKINEMTDQFQKDIDAKNQEIYQLEDNID
ELKTDLEMKVDEVSRLVDNMRTTEVKQRLTSQKLRITEQLLGENEECQLRRVEKLQYDQK
LLEEKIAVLSRMNAAYKEAQANVAAEISEKVNSTLTGMDTFGMKFEEDYGHLESRVYEIM
NELKFTRNWIVGTNAEKRSLKDEISGLIQQLKDEKEKGLKLTVKITELENVVKKGEDEIK
SLTQSAEKRGEKMRELEREMKEKDNGILRLCEEKREAIRQLCVSIDYHQNRYEDLREMIL
IKRGGRRHVAT
Download sequence
Identical sequences A0A022Q860
mgv1a024420m|PACid:17679139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]