SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a026099m|PACid:17682368 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a026099m|PACid:17682368
Domain Number 1 Region: 92-199
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000732
Family Myosin rod fragments 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) mgv1a026099m|PACid:17682368
Sequence length 271
Sequence
MDQKSWLWKIRSTEKTLVADKASNSLSKHDEDENEDADEEDEKLNKVQKLLIEKTDLERN
LRISNEKLSSALSECNAKDNIAKKQVKIAEEAIAEQDKRVHSAMVKRSDEFEKITIALNE
KLADSGKRLAKLGAENTQLSKSLSGKEKVIEDLSKYKTQIEADFSALMSRVESTEKENTS
LKYELRVLEKELHIRNEEREYTRRMADAAQRAKLETSDLCVSWLAVNATMNKREKVLFLF
DVPYFIKEIYLSVTTKFYKVNVNRKFMTSCN
Download sequence
Identical sequences A0A022Q7S9
mgv1a026099m|PACid:17682368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]