SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a026322m|PACid:17686699 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv1a026322m|PACid:17686699
Domain Number - Region: 25-89
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00889
Family Myosin rod fragments 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) mgv1a026322m|PACid:17686699
Sequence length 91
Sequence
MQKEADFKAKNNQLVDEAAVLHLKMVNLQEKITQMERERDAWVLKEDSAKESIASLTNDN
TNLRALVMDLEQSRESLLEETQHLTQIISSL
Download sequence
Identical sequences A0A022RPW8
mgv1a026322m|PACid:17686699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]