SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a027044m|PACid:17671188 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv1a027044m|PACid:17671188
Domain Number - Region: 187-350
Classification Level Classification E-value
Superfamily Tropomyosin 0.000137
Family Tropomyosin 0.0025
Further Details:      
 
Domain Number - Region: 528-590
Classification Level Classification E-value
Superfamily Ribosomal protein S20 0.0353
Family Ribosomal protein S20 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) mgv1a027044m|PACid:17671188
Sequence length 807
Sequence
MEGDNLFKEIDPFGSSPTPILPLPHIDASKNPDGELSVAKLPTNGDLLSSSPHAYGEIEN
KDPPIENHKDFTAITSLSESNISTSALPQGKVESAQYIHDDDVHEFLHDNNNIINNNNNM
EAKIVARPSPDDDYAASSAISPKSTEYYKVPGNVQIDTAAPIESVKAAVSKFGGIVDWKA
HRVQTVERRKFIEQELEKAQEEMPSYKQQCEAAEEAKTQVLKELDSTKRLIEELKLNLER
AQTEEQQAKQDSELAKLRVEEMEQGIADEASFAAKAQLEVAKARHTAAVSELKTVKEELE
QLKRDFSLLIAEKDAAVRKAEEAVSTSKEVEKSVEDLTIELITVKQSLESAHSAHLEAEE
HRIGAVMAKEQDSVNWDEELKHAEEELDKLNQQMLSTKDLKAKLTKATALLHDLKAELAS
YMESKSDETVNLEDALDEPEKKTRSDIEAAISAANEELTQLKLKIEKANDEVNFLKVAAS
SLQTELEKENKEFSAIQRREEMAIIAISSLESEMSKTMSEIALVEMREKEERERMGELPK
KLQEAAREAEEAKATAQTAREELDKAREEAELAKAGAATRESRLRAVRKEIEAAKASEKL
ALAAINALAESESVQNEDDDSSSPAGITLSLEEYYELSKRAHEAEEQANARVSSALSKIE
VAKESELRSLNKLEQVSHEMSERKDALEIAVHKAEQAQEGKLAVEQELRMWRSEHEQKRK
AVETGPAPISTGKSPRASVEEGKGYVVVSDTSTLHQRSPRSIPSNTSNNTETESSPEPKA
VKKKKKSFFPRIFMFLGRRKANASKSN
Download sequence
Identical sequences A0A022RBK2
mgv1a027044m|PACid:17671188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]