SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a000101m|PACid:17670793 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a000101m|PACid:17670793
Domain Number 1 Region: 616-807
Classification Level Classification E-value
Superfamily Sec7 domain 1.31e-77
Family Sec7 domain 0.00000152
Further Details:      
 
Domain Number 2 Region: 383-554,874-962,1135-1303,1330-1395,1424-1517
Classification Level Classification E-value
Superfamily ARM repeat 8.07e-22
Family Armadillo repeat 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a000101m|PACid:17670793
Sequence length 1789
Sequence
MASSEADSRLIRVLTPAFDKIVKNATWRKHSKLAAECKSVIEHLTSPNQNPTPVSSPPAS
PSGQSDSDTSSHPGVLLDLSLADSEIVLSPLINALYSNYAKVTEPALDAVQKLIAHGYLH
GEADPSGGPDGKLLSKLIDSACKCHDLGDENVELLVIKAILSAVTSVSLRIHGDCLLQVV
RTCYDIYLSSKNVVNQTTAKASLVQMLVIVFRRMEADSSTVPLQPIVVAELMEPVEKADA
DGSMTMFVQGFITKVIQDIDGVFSPSTPRGGVGSGVRAHDGAFETKTSTVEGTNPADLLD
STDKDMLDAKYWEISMYKTALEGRKGELAEGEGERDDDLDVQIGNKLRRDAFLVFRALCK
LSMKTPPKDAASDPQAMKGKIVALELLKILLENAGAVFRTSERFLDAIKQYLCLSLLKNS
ASTLMIVFQLSCSIFISLVSRFRAGLKAEIGVFFPMIVLRVLENVAQPNFQQKMAVLRFL
EKLCSDSQILIDIFLNYDCDVNASNIFERMVNGLLKTAQGVPPGVASTLQPPQDVTMKLE
AMKCLVAILKCMGDWMNKQLRLPDSHPSKRLEAAENSSETGSPPSINGNADEAPEGSDTH
SEASSEVSEVSTLEQRRAYKLELQEGISLFNRKPKKGIEFLINANKVGNSAEEIAAFLKN
ASGLNKSLIGDYLGEREDLSLKVMHAYVDSFDFQGKEFDEAIRVFLQGFRLPGEAQKIDR
IMEKFAERYCKCNPKVFTSADTAYVLAYSVILLNTDAHNPMVKKKMSADDFIRNNRGIDD
GKDLPEEYLRSLFERISRNEIKMKEDNLSIQQKQSVNSNRVLGLDNILNIVVRKRGEETM
ESGDDLIRHMQEQFKEKARKSESTYYPATDVVVLRFMIEACWAPMLAAFSVPLDQSDDEE
VIAFCLEGFRSAIHVTAAMSMKTHRDAFVTSLAKFTSLHSPADIKKKNIDAIKAIVMIAD
EDGDYLQEGWEHILTCVSRFEHLHLLGEGAPPDATFFAIPQNESDKSNQARSNILPALRK
KGPGKIQNAASAVRRGSYDSAGIGGNAAAGMTSEQMKNLVSNLNMLEQVGEVNRIFIRSQ
KLNSEAIVDFVKALCKVSMDELRSTSDPRVFSLTKIVEIAHYNMNRIRLVWSKIWQVLSD
FFVTIGCSGNLSIAIFAMDSLRQLSMKFLEREELANYNFQNEFMKPFVIVMRKSNAVEIR
ELIIRCVSQMVLSRVDNVKSGWKSMFMVFTTAAYDDHKNIVLLAFEITEKIVRDYFPYIT
ETETTTFTDCVNCLIAFTNTRFNREISLNAIGFLRFCAAKLAEGNLGEGTSGRISQSSPQ
KGKETQVDNGEPTEKVDHLYLWFPLLAGLSELSFDPRPEIRKSALQVLFDTLRNYGQHFS
LALWEKVFESVLFRIFDDARHAMDPSRDNSPGHIASDDMEELDQDAWLYETCTLALQLVV
DLFVNFYDTVNPLLKKVLMLLVSFIKRPHQSLAGIGIAAFVRLMSNAGEMFSEDKWFEVV
SSLKEVATETLPNFSFMLDEDGKIWTHEDESNANNANNRDESSEPITSNEDSDSNLRRQR
LYSAISDVKCRAAIQLLLIQAVMEIYTMYRAQLSVQNTVILFEAVHAVAFHAHKTNSDAA
LRPKLQELGSMTQMQDPPLLRLENESYQICLTLLQNLVLDKPPNYQESEVESYLVNLSQE
VLQFYIEVACSGQQQQQLMPDSSSLDRQPQWTIPLGSGRRRELAARGPLIVSTLQAISSL
GDSSFEKNLSLFFPLLSSLISCEHGSNEVQLALSDMLSSSVGPVLLRSC
Download sequence
Identical sequences A0A022QXF5
XP_012843612.1.32330 mgv1a000101m|PACid:17670793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]