SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a002206m|PACid:17680716 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a002206m|PACid:17680716
Domain Number 1 Region: 63-173,610-640
Classification Level Classification E-value
Superfamily TPR-like 5.36e-24
Family Tetratricopeptide repeat (TPR) 0.0022
Further Details:      
 
Domain Number 2 Region: 208-267,384-472
Classification Level Classification E-value
Superfamily SET domain 2.75e-17
Family Viral histone H3 Lysine 27 Methyltransferase 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a002206m|PACid:17680716
Sequence length 701
Sequence
MEKLKSVIPETLKLEISQSTIDELHCTCSSLLNFFQNLPLFHQMVRELTDPEKALCGKNK
EAAMEAKAKGNECFSKGEYSTALHFYSQALRAAPADVEDKEKNLVAMLYLNRASTLHKLG
FFLESLRDCSRALIVSPAYAKAWFRRAKANSSLGNYEDAIKDLTVSLKIETSSSGKKQIE
NELNMLLNKSGLSRAIEKPYHDSSEERLLMELKYVSTTTKGRGMTSFTDIPLASLIHKED
PYAAIILKNCRETHCAFCFNELPADTVPCVSCSIPLYCSLNCQVQAGGEDFSLCKDKYRL
PQELSDDLEQYAKNVTSPDISSSSIEHAAEHKHECQGMHWPAVLPSDVVLAGRILIIMLL
SRIRVNSMAIVRMNHPDGRQNLDYNATSSVEQVQVAQAVYSSGSLFNHSCVPNVHAYFLS
RTLFMRATENVTAGSELELSYGPQVGQWDCSERRKFLEERYSFICQCSGCSQLNFSDLVH
TGYRCSIPNCSGVVLESCVAKYEKEKLKHFKGPDSLQQYILKDDKIGGVASHVFEQNDYY
RCFEPGHCLSCGSFRDLPASQKTIVKAEIRVRRLQEAVASGEIATDLVVDALKSIDILRT
VLHPFNKRIAEVEDIIAQAFCSIGEFQAALKHCRASIEILEKLYGESHIVIGNELIKLAS
IQLSNGLKNGADNTSRTVAIFSQYYGSHADNMFPHLRYLKS
Download sequence
Identical sequences A0A022Q0V6
mgv1a002206m|PACid:17680716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]