SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for mgv1a002959m|PACid:17690862 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a002959m|PACid:17690862
Domain Number 1 Region: 147-258
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.7e-42
Family B3 DNA binding domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) mgv1a002959m|PACid:17690862
Sequence length 621
Sequence
MMCGLIDLNTVDNEDETASPSGSPTSSAASGNFEFSVPPSSAAVCMELWHACAGPLISLP
KKGSAVVYFPQGHLEQLREHTAVAYDLPPHVFCRVVDVKLHADAASDEVYAQVSLVPDQQ
IEQNWREGMIETEVEDEDPEGMGKSMTPHMFCKTLTASDTSTHGGFSVPRRAAEDCFPPL
DYKQQRPSQELVAKDLHGVEWKFRHIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFLRG
GDGELRLGIRRAAQVKSNATILHPNSNHFNASSVVAVVNSISMRSTFNICYNPRAHSSEI
IVPYHKFSKSLTHSFSCGMRFKIRFETEDSSERRCSGLIIGVNEVDPARWPGSKWKCLLV
RWDDMDVNRLNRVSPWEIELSGSVSGSNSFVLPGNKRDGNEVSDFGEPLRFQKVLQGQEV
FAFRTPYAGAEASRHHQSDMRCYPGLSMRHLHPDSFDTSVLGESFQFQNKVLQGQETISL
YGRGPQANHHTPQVDNNAANIINGVQVSNHGNSWSTLPQVFNSNPHRSLPFQFTPSANHG
DHGMVPTGGKEVAFPHRPVPTQQFFRDNENFVSMCKNSCRLFGFPLTEGKITTMGMGENA
TASSGSASAYGVRDRLLDIAL
Download sequence
Identical sequences A0A022QL99
mgv1a002959m|PACid:17690862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]