SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a004165m|PACid:17686833 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv1a004165m|PACid:17686833
Domain Number - Region: 205-328
Classification Level Classification E-value
Superfamily Tropomyosin 0.00118
Family Tropomyosin 0.0097
Further Details:      
 
Domain Number - Region: 342-529
Classification Level Classification E-value
Superfamily Tropomyosin 0.00785
Family Tropomyosin 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) mgv1a004165m|PACid:17686833
Sequence length 541
Sequence
MENEVSKLDSPSWNSQICLKNPEWVAENVKGLDQSVNEMLLLIEDEEHFSFEKVVDSNSK
QPELIARVKEISERHHLLADHYKKLSGELSGGYVKSVNRLKNYEKPSFGSPLAPLFQTPD
KKLTMHGVVEGEVVGSDISLSSGGGISDTTPGSESSSLSSDSDSESYYTSRGERSSSLSS
GKMMKHEAIHMETEQEHIHDIKKAEECEILERRISDYERELKVSNEKLRTAEEEILQLRS
ELRNSEAAAVEVGSLQAQLLSAKNQVKLHEFELEKENGRSLMLQRQIVDLESNLESEKMQ
VHELQGSVKKYAAELSDRDLDIKKLNAELLDASGNFALEKWQLESSVSSLSEQLKFHEAK
TENLQMQCESLADQIKNFEAGKIEMERKQEAMNINWQNDIERVKVEVSEKNELVNTLNKN
LDGMKLKYDMLNAEKDGVIAKLQTLIADLSARDSEIQRLEHNLNELHSENKVLNKLRDEL
KSKINELEKEVKMQAEMISDTSEEKREAIRQLCFSLDHFKSAYVELREECVMRKRPMAVV
S
Download sequence
Identical sequences A0A022R4K9
XP_012839987.1.32330 mgv1a004165m|PACid:17686833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]