SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for mgv1a004496m|PACid:17682794 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a004496m|PACid:17682794
Domain Number 1 Region: 29-123
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.47e-22
Family B3 DNA binding domain 0.0017
Further Details:      
 
Domain Number 2 Region: 433-500
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000184
Family B3 DNA binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a004496m|PACid:17682794
Sequence length 524
Sequence
MVRRVVAPDSCGKNREAFREKQKEVSPIVTRFIKIMIGKDHTEVLYLPRKFARKVVHLAN
QETEIEDSNGEKWPVTFSYFDGSLSLHKGWNRFYQEHRMEMGDFVVFNYKEGSHFVVQIY
GRNALERINFNKVRTRENKRPRPDPPAFPQEEEPLSGPDSRKRKTDPVEKKNADVADLTC
MIDLTCMVDRDNVHYEREDRGFLFDLSNFEMKKEALDPNKIVGPVQMDVEINKLDTNEES
SRAEMDVICEGDLGNGFGGEIAPRDAEFTVDATPIKGEEIASCYAEFTVDATPIKSEDVA
PCHAQITADATRVDVHSDKFLAESSDKSNSCKNAIDNIISSFRDVLEKSEVFAGKEYASP
FASSALKDLFGKCAIKKELVEVEDIPDRFLGVSCDAEKVTSAPLVVKPEPDLLYDAVPFG
AIGQFSAVVKSLSFLELPIHIPSHPTRRESGYGKFVRVRDPMGRHWMILNPAIFSLKALT
GNWTEFCLANGIKLGDECRFNPKMMISTLTGLILFVINGEFLRG
Download sequence
Identical sequences A0A022QLX3
XP_012847841.1.32330 XP_012847842.1.32330 mgv1a004496m|PACid:17682794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]