SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a005850m|PACid:17682639 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a005850m|PACid:17682639
Domain Number 1 Region: 90-219
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 6.15e-18
Family alpha-D-mannose-specific plant lectins 0.0055
Further Details:      
 
Weak hits

Sequence:  mgv1a005850m|PACid:17682639
Domain Number - Region: 354-391
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0549
Family Pan module (APPLE domain) 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) mgv1a005850m|PACid:17682639
Sequence length 468
Sequence
MKIISVFITLLPLVIILNLIMADQALSESYIQIGYEVTLAVPTVYTKGFVGRAFLTEVQQ
AAAPHFRAAITVEAAVEEENNYYSCSLDILLGDVRVWTSGHLSRFYTTGKCVLELTQYGD
LRLKGQNERVGWRSGTSGQGVKRLNLLRTGNLVLVDALNLIKWQSFNFPTDIMLWGQRLS
SQTRLTSFPVNSTLFYSMEIQYDKIALYLNYGKWKYSYWEYQPSIKKNITFMQLTSTGLE
IFNGKNKFDSIKSNDPPRFLSLEKSTGNLNIYHYSEDKGKFEATYQALNLSCDLPLSCNK
PYWICTLSGECSCIRVNAHRSDCFEGNIEGLCGKKNAEMVELRGVISVIKSVSSYGSGNY
NNVGKKECGELCLDDCTCVAAEFDFGECNLYKMVRGIKQVEGGSGDIKYMIKVAKGTIIE
GYGSNYGLKRWVIIVVGVVDVFVIILVLGGLGYYFVIWKRRKDSLVND
Download sequence
Identical sequences A0A022RSV9
XP_012832248.1.32330 mgv1a005850m|PACid:17682639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]