SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a010945m|PACid:17682957 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a010945m|PACid:17682957
Domain Number 1 Region: 152-231
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000468
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 
Domain Number 2 Region: 264-296
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000824
Family CCCH zinc finger 0.0021
Further Details:      
 
Domain Number 3 Region: 95-126
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000222
Family CCCH zinc finger 0.0032
Further Details:      
 
Domain Number 4 Region: 36-64
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000994
Family CCCH zinc finger 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) mgv1a010945m|PACid:17682957
Sequence length 296
Sequence
MDFGRKRGRPDAAFSGNGGSKKYKEETDSFTSGVGSKSKPCTKFFSTSGCSFGDACHFLH
YFPGYNAHSQLANMGGNTAAPAGRNGAFTDNPSPSMKTRICNKINTAEGCRYGDSCRFAH
SEMELGSKPPPMHGYEDHRMMGPPSGFPQRLEPVANFGASATAKISVDATFAGPIIGKNG
VNSKQICRQTGVKLSIKDHETDPNQRNIELEGTFDQIKEASSMVRQLIMNISAAGGRGEK
PPMGSFGGHGGGGGGGGGGGGGPPSHYKKKMCEKFPKGLCTFGDRCNFAHSTSELR
Download sequence
Identical sequences A0A022QHP9
mgv1a010945m|PACid:17682957 XP_012849750.1.32330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]