SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a011108m|PACid:17682573 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a011108m|PACid:17682573
Domain Number 1 Region: 258-288
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000772
Family CCCH zinc finger 0.0016
Further Details:      
 
Domain Number 2 Region: 179-232
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000206
Family Eukaryotic type KH-domain (KH-domain type I) 0.0038
Further Details:      
 
Domain Number 3 Region: 105-137
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000314
Family CCCH zinc finger 0.0021
Further Details:      
 
Domain Number 4 Region: 38-63
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000903
Family CCCH zinc finger 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) mgv1a011108m|PACid:17682573
Sequence length 292
Sequence
MEFGGAKKRGVPEGGFNGNGGFKKSKQEMESFTTGIGSKLKPCTKFFSTSGCPFGEGCHF
LHYVPGGIKAVTQILGNNPALPAANRNPVAPPPQHPPSFQENRPLAVKTRLCNKFKTAEG
CKYGDTCNFAHGEWELGKQTLPPHDDPRSNTGQMPGRYGGGGGDYMEAAPPNHGMAAASF
GASATAKISIDASVAGAVIGKGGVNSKQICRMTGAKLSIKQASQMVRELIVNIRAGSGPP
SRSHHGMSGHNSAPSSNNFKTKLCEKFTRGSCTFGDRCHFAHGEEELRKSGV
Download sequence
Identical sequences A0A022PUV2
mgv1a011108m|PACid:17682573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]