SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a011179m|PACid:17683682 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a011179m|PACid:17683682
Domain Number 1 Region: 156-235
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000555
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 
Domain Number 2 Region: 96-128
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000249
Family CCCH zinc finger 0.0029
Further Details:      
 
Domain Number 3 Region: 257-287
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000471
Family CCCH zinc finger 0.0016
Further Details:      
 
Domain Number 4 Region: 33-58
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000017
Family CCCH zinc finger 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) mgv1a011179m|PACid:17683682
Sequence length 290
Sequence
MDIRKRGGGEFPNGSFKKFKPEMDSLSSGIGSKLKPCTKFFSTGGCPFGENCHFLHFVPG
GYKTVAQMMNLSPAPPSRPVHGPPPPVQSHNGSAPSAVKTKVCVRYKTAEGCKFGDNCNF
AHGEWELGKPIPPSQENPRSVGPATNQTRYAPRVDPPPAVSFGASATAKISVDASLAGAV
IGKGGVNSKQICRQAGVKLAVRDHETDPNLRNIELEGSFEQIQQASAMVRELIVNIGSAA
RAHAKGSGAMSGSTGNFLKTKLCEKFSKGSCTFGDKCHFAHGAAELRKTG
Download sequence
Identical sequences A0A022Q2F0
XP_012857451.1.32330 mgv1a011179m|PACid:17683682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]