SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a012129m|PACid:17691548 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a012129m|PACid:17691548
Domain Number 1 Region: 186-252
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.43e-22
Family DNA-binding domain from rap30 0.0022
Further Details:      
 
Domain Number 2 Region: 9-118
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 0.0000000000000016
Family Rap30/74 interaction domains 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a012129m|PACid:17691548
Sequence length 260
Sequence
MADELSNNDKITLDTAKSDRSIWLMKCPPVVSKAWKSAAAESPPVAKVVVSLDPLRPEEP
SSLQFTMEMAGSEIVQMPKSFSLNMFKDFVPMTVFSETNHGSVALEGKVEHKFDMKPHHQ
NIEEYRRMCRERTNKSMVKNRQIQVLDNDRGVHMRPMPGMMGMISSTSKDKKKAAAPPIK
GPDVKRTRRDRGELEDIMFKLFEKQTNWSLKQLVQETDQPAQFLKEILNELCVYNKRGAN
QGTYELKPEYKKSAEETAAE
Download sequence
Identical sequences A0A022QZW6
mgv1a012129m|PACid:17691548 XP_012842773.1.32330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]