SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a017829m|PACid:17673135 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a017829m|PACid:17673135
Domain Number 1 Region: 310-614
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.83e-81
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 2 Region: 6-48
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000317
Family alpha-D-mannose-specific plant lectins 0.025
Further Details:      
 
Domain Number 3 Region: 6-19,51-82
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000208
Family alpha-D-mannose-specific plant lectins 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) mgv1a017829m|PACid:17673135
Sequence length 643
Sequence
ENDKNTENYLWQSFDHPTDTLLPGMKLGWDAKTGLNRYITSWKSADDPSTGDYSFKLNIN
GFPEIFLTDKRVVDYRSGPWNGLRFSGVPEMKPSPLISFSFVMNPDEVAYSFNVNNKSVY
SRLLVKHSGALQRFIWIPTSKIWNLFWYAPKDQCDDYRECGAYGLCDTNSSPVCKCMKGF
EPRNPQAWYLRDGSGGCIRVGKLDCGSDGFLTLRNVKLPESGTAFVDKRMDLDGCRELCR
RNCTCMGYSNANITGGGSGCVVWAADLYDMRQYAAAEGGQDFYLRVPAADLGIKRDHYST
ETEGDELDLPLLDIATLLIATEDFSDANKIGQGGFGSVYKGVLAEGHEVAVKRLSKTSGQ
GIDEFKNEVKLIARLQHRNLVRLLGCCIDMEEKMLVYEYMENKSLDSFLFKKDRSSMLDW
RTRFSIICGIARGLLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDQTE
ANTKRVVGTYGYMSPEYAMDGLFSIKSDVFSFGVLVLEIVSGMKNRGFYQTNNQLNLLAY
AWKLYREGEGLKILDKAAGETYSASEVMRCIQVGLLCVQEHTEDRPNMSTVVLMLSSDFV
SMPQPKHPGYCLGRRPHDNDLSPPKQDESCTINQVTVTMMDGR
Download sequence
Identical sequences A0A022QJW6
mgv1a017829m|PACid:17673135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]