SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a019293m|PACid:17687725 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a019293m|PACid:17687725
Domain Number 1 Region: 166-228,298-380
Classification Level Classification E-value
Superfamily SET domain 3.27e-25
Family Histone lysine methyltransferases 0.095
Further Details:      
 
Domain Number 2 Region: 4-110
Classification Level Classification E-value
Superfamily TPR-like 6.4e-16
Family Tetratricopeptide repeat (TPR) 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) mgv1a019293m|PACid:17687725
Sequence length 532
Sequence
MENLRSKATELLLREEYKPSIQAYTQIISLCQTRIAAKNPDGPHLNKLLCLSFSNRAEAR
ARLSDHTLALTDCEEALRIDDSHFKTLVCKGKILLSLNRYGAALCCFNAANLGPQASENS
DLVNGFLEKCKRLEFLSRTGAFDISEWVLSGFRGKSPELAEYIGALDIKKSEISGRGLFA
TKNVESGTLLFVTKAVAVDRAIMPQDSGENAHLVIWKNFVDKVSDAAGKCSGLTNLIWNL
SSGEEDEENTMEVPRIGIFRPEEFDTDSCKKKKKVLDMGRLLSILDANSFLEDSISAKVL
GKNADYQGVGLWVLASLINHSCEPNVRRLHVGDHVVVHASRDLRAGEELTFAYFDVLSPL
SKRREMARSWGFVCGCKRCKFEENLGCKHETREMEILMMGGKGGVDMGGVVYRLEEGMRR
WGVRGRGKGYLRGSFWEAYSKVFGSEKVMRKWWRKIPEGEAVVDSVVDAVGSDERVVKVY
LEGLKRGGSGGGGGGGGINGVVEMEKAMKLARGVYGKVMKKHALRSFIHFGE
Download sequence
Identical sequences A0A022QLE6
mgv1a019293m|PACid:17687725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]