SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for mgv1a021192m|PACid:17690377 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a021192m|PACid:17690377
Domain Number 1 Region: 60-174
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.11e-31
Family B3 DNA binding domain 0.0000211
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a021192m|PACid:17690377
Sequence length 303
Sequence
MSINQYYPSDWWSYPIPNSAAAAPLHLNHGTSAAAFCSQSAAFCYSHNNNETEEESPEET
NKPLFEKSLTPSDVGKLNRLVIPKQHAEKYLPLNNGGGSGGGDTGEKGLVLSFEDEVGKS
WRFRYSYWNSSQSYVLTRGWSRFVKEKRLDAGDAVLFLRHPEDVGRLFIGWRRRNSGGGG
GGGQEISSVASASANVRRTPPAGGGGGGWSRLVYNNPAGHPYLISQYYQDYCSSSLSYHY
QPPNDCPHAADADRKETAAASGNLKRVRLFGVNLDQWESSSSEPLSSPEGSSMARTHYHP
YHD
Download sequence
Identical sequences A0A022RID0
mgv1a021192m|PACid:17690377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]