SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a024508m|PACid:17686294 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv1a024508m|PACid:17686294
Domain Number - Region: 374-443
Classification Level Classification E-value
Superfamily Tropomyosin 0.00229
Family Tropomyosin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) mgv1a024508m|PACid:17686294
Sequence length 874
Sequence
RAASNAYSWWWASHIRTKQSKWLEQSLQDMEDKVKSMLTLIQEDGDSFAKRAEMYYKRRP
ELILSVEEAYKAFRALADRYDLLSKELQNANHTIATVFPEQVQFDISEVDEDYVGPPPPN
IIPSKTQQIPEVPKKAPNKNLKRIIAKASKEIKDKKKAAESEQKSGLTKEEALEEINKIQ
KDILALQTVKEFVKSSYENGVAKYWGIESQITEMQKKVSKLQDEFDMDVVIEDDEARRLM
AEAALKSCQETLILLQEKQEKSTREAKEEYKRIEAACQRLQTLKQKYMQEQQQTTYVENN
ESQKDVIELILETKEIEGLNGPAQESCDLGSNAPLSVSQLAEKIDQLVNKVIGLETAVSS
QTVLVSTLKTETDDLNNQIRNLEEEKENLVDDTQVLSTRVREMEGRLNKIQDLNKNVESR
SSNLQTNFAEARSNLDRLSEKLTSVKPDEEIEEVIKAKEDVQILSASDKKPGAVLKTEAT
EEVKEVDKNVKVCDLSVPEQGMVQRGFRKSITFMDRKPKEATNAEKEDDVNWQMMLLSGM
EDKEKVLLKEYTTILRNYKEVKKKLTDMEKKEKDSQFDTVLQIRDLKRGMSRKDEEIQNL
KQRLNFQGGGDINLMNEHNNPVANEDDEEEIKLIFIDRTPSISRVEEKLRTDIDAILDEN
LDFWLRFSSAFHQIQKFKTEAQDLQDEISKIREKRKPDGSMAAQAKSEARPVYKHLREIQ
RELGAWLDQSASLKDELKRRNSSLCGIQEEIAAALREGVEGDAIGFSSHQAAKFQGETLS
MKQENSKVREELQAGLDHARVLQVDIEKTLRSLDEEFGISGGGQSENLSRPRVPLRSFLF
GTKVKKPKQSIFACMHPSRRYQILKAGIRLSKIN
Download sequence
Identical sequences A0A022QWP9
mgv1a024508m|PACid:17686294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]