SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gnl|MincDB|prot:Minc00590 from Meloidogyne incognita

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gnl|MincDB|prot:Minc00590
Domain Number - Region: 207-255
Classification Level Classification E-value
Superfamily TM1646-like 0.0759
Family TM1646-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gnl|MincDB|prot:Minc00590
Sequence length 257
Comment length:257 contig:MiV1ctg7 region:293947-295871 strand:+
Sequence
MFPSFSKQPAPENTQNSSLNICCNDDYLDLLFGASLPLDQVCYAFAYGSGAIPQKGENQK
EKMVDFILVCNNSMLFHQKNQLWNPAHYSLPWRLFKTERLINNLYWFQRDGFLFPKGAKL
FYNTLIPSRGRLIKYGVIDTEDFEADLLDWPKLYIAGRLHKPVLNVLVWPNNQNVGQSPN
RPIWQAINDNRWMAVQAALLLLPDKFSVKEFLHKIVGLSYKGDVRMGWAEDSRKIDKLVE
GANEQLRMLYIPLLKKF
Download sequence
Identical sequences gnl|MincDB|prot:Minc00590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]