SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gnl|MincDB|prot:Minc02094 from Meloidogyne incognita

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|MincDB|prot:Minc02094
Domain Number 1 Region: 97-182
Classification Level Classification E-value
Superfamily TM1646-like 0.0000785
Family TM1646-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gnl|MincDB|prot:Minc02094
Sequence length 507
Comment length:507 contig:MiV1ctg37 region:149764-154379 strand:-
Sequence
MKSKATRQRLMVSIRKNGVTDADNVNGLLLNLSNDFNFVVKGDQLNEQTNTENVIKLHVI
SEFIGNIKNSKNAENLIELQDSNNLPKQISVPEVLSELDKLMIKETEKQILVQRMAKLEE
LTRYRKQINSIVKKTKKEFYFVQDTQIFENIGIRIFNCIQELDLAFGKFMKSVINDKKEE
IKNIIEKGKKKFLTKSIKEKLSKFKAFGYNHMETTSEEKNLFYIVDTPQRKHLKFVKADL
TDKIKEKANLIKEIKNLKHQIQLKPRLINEMKKLMLNTSHKGDEFNELNAKIEALETKIK
KLELYIEIYKQMNIIVDGIYDNINKLYSEGDLAQINYNKLFIIEPYNEYRLYKEFNYVIS
SMYANLTKIFDGEKEPKLLTEVVVLRDIITEYTNVLGIQEAELKARLTIKDKKHSEKEKN
LTESENEVDVQDEINDLKNKTKSYLSNVLLAYEQISDIIIKNTSGKSISNNYAKIKSELL
KTLKKAETLNSELKKSFASDILAYYQK
Download sequence
Identical sequences gnl|MincDB|prot:Minc02094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]