SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gnl|MincDB|prot:Minc07287 from Meloidogyne incognita

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gnl|MincDB|prot:Minc07287
Domain Number - Region: 22-89
Classification Level Classification E-value
Superfamily TM1646-like 0.00301
Family TM1646-like 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gnl|MincDB|prot:Minc07287
Sequence length 101
Comment length:101 contig:MiV1ctg215 region:90747-91221 strand:+
Sequence
MIYSYNNAQELSEDEMKLFIQKRLSNMLITVNFEGYKELLKEYLKFVKSENEEILIEKNI
NVDRLLNNKTQNLEQFVKIVNEEILPLLNIQMNMPHASQAS
Download sequence
Identical sequences gnl|MincDB|prot:Minc07287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]