SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gnl|MincDB|prot:Minc17647 from Meloidogyne incognita

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|MincDB|prot:Minc17647
Domain Number 1 Region: 14-93
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.69e-18
Family Glutathione peroxidase-like 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gnl|MincDB|prot:Minc17647
Sequence length 152
Comment length:152 contig:MiV1ctg1507 region:2068-3068 strand:-
Sequence
MHIVSPLNLDSISGIPLTVRAVFFIDPQKRLRLSILYPASTGRNFDELLRVLDSMRLSDE
YMLATPEGWNNGSPCMIEPKVGSEEANKLYSSINTLQLPSGKGYMRVVDQPLISENKKEE
SMAQCSMADTFKSVNKRFFNYTNSAMPTSCLV
Download sequence
Identical sequences gnl|MincDB|prot:Minc17647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]