SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gnl|MincDB|prot:Minc00114 from Meloidogyne incognita

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|MincDB|prot:Minc00114
Domain Number 1 Region: 117-157
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000694
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 2 Region: 223-256
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000106
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 3 Region: 59-97
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000236
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 4 Region: 2-33
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000511
Family LDL receptor-like module 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gnl|MincDB|prot:Minc00114
Sequence length 263
Comment length:263 contig:MiV1ctg1 region:62506-67067 strand:-
Sequence
MCRKTKACIDNKLVCDHKYDCTDGSDELTCDYFINSQMREKARLLKIEEEKLKKEKEGQC
GPEQVRCPETAPNRCIHYTSICDNKDDCGDGFDESTCRNDGESRDEEKVITIRPENVMNG
YCAPGEFQCREGGCIPASSHCDQKYDCEDGSDETECSYFREAEERRRKEEEEQRRRQEQE
NEQKRRQEQEDERKRLEEHQAQIQRQRAEQERNQRIEDCRRRGGFLCPGTDRCIERAYFC
NGRSDCPNGDDEKNCPVSEEVPG
Download sequence
Identical sequences gnl|MincDB|prot:Minc00114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]