SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gnl|MincDB|prot:Minc07096 from Meloidogyne incognita

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|MincDB|prot:Minc07096
Domain Number 1 Region: 445-705
Classification Level Classification E-value
Superfamily YWTD domain 1.06e-41
Family YWTD domain 0.0000592
Further Details:      
 
Domain Number 2 Region: 3339-3602
Classification Level Classification E-value
Superfamily YWTD domain 1.05e-39
Family YWTD domain 0.000021
Further Details:      
 
Domain Number 3 Region: 1517-1741
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-35
Family YWTD domain 0.0000333
Further Details:      
 
Domain Number 4 Region: 2137-2377
Classification Level Classification E-value
Superfamily YWTD domain 3.92e-30
Family YWTD domain 0.00017
Further Details:      
 
Domain Number 5 Region: 2488-2708
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-28
Family YWTD domain 0.00028
Further Details:      
 
Domain Number 6 Region: 1864-2084
Classification Level Classification E-value
Superfamily YWTD domain 7.85e-27
Family YWTD domain 0.00027
Further Details:      
 
Domain Number 7 Region: 805-1013
Classification Level Classification E-value
Superfamily YWTD domain 4.71e-25
Family YWTD domain 0.0016
Further Details:      
 
Domain Number 8 Region: 4213-4287,4321-4479
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-23
Family YWTD domain 0.0004
Further Details:      
 
Domain Number 9 Region: 3254-3334,3595-3656
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000022
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 10 Region: 1358-1396
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000497
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 11 Region: 1229-1270
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000929
Family LDL receptor-like module 0.00062
Further Details:      
 
Domain Number 12 Region: 3149-3191
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000929
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 13 Region: 4058-4180,4490-4569
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000235
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 14 Region: 1106-1136
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000353
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 15 Region: 3879-3916
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 16 Region: 2837-2878
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 17 Region: 256-296
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 18 Region: 1268-1310
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 19 Region: 3773-3808
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000223
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 20 Region: 96-134
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000262
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 21 Region: 3961-3999
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000353
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 22 Region: 1191-1229
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000524
Family LDL receptor-like module 0.00069
Further Details:      
 
Domain Number 23 Region: 3214-3249
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000707
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 24 Region: 3690-3727
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000772
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 25 Region: 217-254
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000772
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 26 Region: 3035-3067
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000249
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 27 Region: 299-336
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000471
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 28 Region: 1316-1352
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000576
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 29 Region: 2980-3021
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000694
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 30 Region: 2897-2934
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000144
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 31 Region: 3648-3684
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000236
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 32 Region: 3730-3768
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000249
Family LDL receptor-like module 0.00072
Further Details:      
 
Domain Number 33 Region: 1147-1185
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000825
Family LDL receptor-like module 0.00095
Further Details:      
 
Domain Number 34 Region: 3914-3954
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000034
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 35 Region: 2801-2840
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000393
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 36 Region: 2944-2982
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000055
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 37 Region: 3070-3118
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000838
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 38 Region: 136-178
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000144
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 39 Region: 1427-1469
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000359
Family EGF-type module 0.018
Further Details:      
 
Domain Number 40 Region: 1747-1785,2085-2132
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000377
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 41 Region: 177-212
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000072
Family LDL receptor-like module 0.0022
Further Details:      
 
Weak hits

Sequence:  gnl|MincDB|prot:Minc07096
Domain Number - Region: 3815-3846
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00017
Family LDL receptor-like module 0.0032
Further Details:      
 
Domain Number - Region: 344-387
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000375
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 1465-1502
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00044
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 4003-4044
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00157
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number - Region: 713-760,1040-1132
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00706
Family Growth factor receptor domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gnl|MincDB|prot:Minc07096
Sequence length 4743
Comment length:4743 contig:MiV1ctg206 region:35942-58576 strand:+
Sequence
MLFLLFKYFLLPIFLLNLFCLPRLCINLDTKFPIHTIQRILLGVEPPHPFHRGPPGVRPG
FISGTVFTTDAEAPSIGHRGAHRSHLQQQSSSGSSSRVCSETEFRCDDGHCIRLEWKCDG
SGDCRNGEDENNCPHPGCKAEQWQCDKYDIHSVSCIQEYQRCDNISDCVDGSDEKDCPAA
PVNCEVNDGSCFPITRKCDGIYDCRDLSDEKESCSTNHTACFPYQFRCADKTQCIQKIWV
CDGTPDCADKSDEPPTCTFPACQTGDFKCKNKRCVPQKFRCDYYDDCGDNSDEEECGHYK
CPPDMWPCPNSGHCIHLSKLCNGVNDCDSGADEKTCSRNLCQTLGCQSGCASSPTGGICT
CPQGYKLDERFERSCIDINECADFGYCDQTCQNHRPSFTCGCLGSCFKLQMVQSTGANSG
SPFGGSNNLTLRGYCISSEPEQMRLFVARREGLYRLNPANKEESAVKIASGEFIYGVDFD
YEKRKIFWTDRLAHSLYRADITSGGDIEHIHKFELKSLIYPRNLAVDWITNNIYVIESGS
RRIDVLNYEGDKRTVLLADGLTLPLDIALDPLRGEMFFSNQLKLETCHMDGTSRRVIVET
HTHQVSGVVVDIAAKRVYWCDPKVDRVESVDYSGNDRRQISSGRNFAPHPFGLAIFDQYL
YWTDWTRLGIMRVEKFGAASEVIWSNKDGNVFPMGIAAYHQMAQPGPSHSDCFQQHIENP
CDKADCEGMCLLAKDNVGFGVGYRCACPIGQKLVDGKRCVPSIDYLLFSSNRVIRGIYPE
ILQNTLAEAVLPISPQSQRRVGMYFAVECDVHSSSFFYADIMDNTLYRVKPDGEGSAPIL
VTHNDGLISMSFDWLSRQLYYIDNIRNSLEVVKVTDQGLVNPEQLVHRKLLVKLRDPVSV
VVHPWRGYVFFAEAERPARIWRCNLDATNCIVLRNQTIGRPSGLAIDFAESRLCLGDSLL
KFFACMDFDGQNWAVLPVEDPIPVAITFLGDQIYYVHQRPYSIRRVSKNFGGVGRIVRCS
TQNQPASDPSHKYPDHLKHPCQEHNCAHFCFALPSDDHSMPLTKKCGCKHGYKVNPNNEL
ACIRDILEPIEPLCPRNGSQKNELALQFQCANGRCIPLEWRCDSEDDCLDGSDEQDENGH
SCFKEVECPEATIRCNNTKKCIPVQYACDGDNDCGDFSDEDQRFCKDGQRPQCGAKKFQC
DNNRCVPEQWRCDSDNDCGDGSDEKLELCHNATCSSNQFTCANGRCIPVYWLCDGDNDCY
DATDEDPERCPPVQCRPDQFRCASGRQCIPLANHCDSQDDCNDASDEESCLPREGNCAAD
QFKCVTSGICIPAAWKCDGQEDCDDASDEPRETCQLQHVTCPKDHFRCTNGRCIFSTWVC
DSVNDCGDNSDEQTCPNSASQFLYKCPFDTVSCRNAPEQCIHYSNLCSADRAGCQYKCHN
SPDGPICSCPLGEQLVNKTRCEPENECLDPRSCSQHCTDEKHGFTCTCDTDYVLSADKHT
CKVAQNREDMRVYVSNRNQNWRTFAAQVENAVAIAWDSVQDRIYWSDIRDKKIYSATRNG
TDVQVFIGQGLDITEGIAVDWVGRNLYWVDSSLNTIEIAIRSILLHEGIDQPRGLAVDPS
CFNRANMDGSNRVVLVDTKIYWPNAIALDYTVSRVYFADSKLDYIEFVDYDGKGRVQVLA
STKLIQHPHAMSIFEDHIYYSDRRLQRLQLYPKYPNGTSREYPSHSFSKALGVIAIHPVL
QPQIKENPCSTSGCSHICALGANGTFTCLCPSGHVIEEGGGGRQCVLDKRPFMLLVHKSM
VVGAALNNEGESSNKKHLPHEIGGIVPISGLRNTDDAEYDPLTNELFYLEHGAPVLLMTA
TLMSSSMIHKTSLTSNNRSLILANQPPDDPSCMAYDWNGRNIYVGKKHSQTIEVVRTQGE
QFHTVILHNDQSPTAVSNPVAIAVDSDRGLLFWLDQGKGGVSTKLAGADLDGNNPLVLVS
TDLAELDHLALDTVNRRIYFTEAKAGRITSVSYSGQDKRYILNDAAKQPRAIAFFHNHIY
YADTAFDKIMVGDVDTGSGDDQPPEFTEFRANVEHLTNMHVVHPANTRESHPCHNNNGNC
EQLCIPRGQQNKFTCICGTGFSVDEETNKCKLSAESFLIIAGKNYIKSIPTDPLRSKVTA
FDPLAGTTITSLDFHYDSKSIFWVDAAGLNKGISRLVLGESESRLIIKNNFGGFTIKSVA
VDWVNSNLYFVNADSDRSNIEVAQLNGENRKILLTTRTETPTSLAIDPIARYIYWADQGQ
TPTIQRAWLDGTHKQVIVHTELKEPTDLIVDPNSHYLYWTDAGMDGIFRVNPMALHTTDG
NSELKPELVRSDIAEATGIAIVGQNMYWTDRRLEKVFASTSKPNQSSLLLSPSTMIGDLP
ELSDLSAFDPLAQPKSNSPCHISESLRKSPCPQLCFALPGSSSPNCACAKEPDSFLMFID
GDRIVDATLVPDIKASSPLRDAFPPMPNIQQFDVDVNLRRIFFVTESPSGANISWFSISQ
PKQLRQIINAERLRTPELKEANRHISDMRLDWFTQKVYWTTGKSGKVYAYDINGNHIMTI
ATGDWTYAMALDPCSGLLFWSDSGYKVSGGSYEPRIERANMAGGQRRVLVREDLSLAATL
AVDSREQRLYWADVNRLSIESIDYDGNNRRLIGIGFRAKSLDIWQNWLYMSDPLSNGIFR
MNKFTGNSYENVADIRTRNQWCSERTAHACAKNNGGCDQICHVVAADDPELGGGAGGTIA
AHRVQCACNDTFHIVKQPGEDIATQCAPNDAASGTKSGGSCEGPYNFQCVGDGSCIALDR
TCDGKMDCPDSSDESPSYCFVRFCPEDYYLCANRRCIQESGRCNGVNDCGDHSDELDCGN
FKPGSRPGSSGSGSPTTTVCPPGAFACTNGHCINQSRVCDGHIDCQDENVSDENSKTCPG
LPIDCRGVRIKCPKTNVCIQPSDLCDGYDDCGDLSDEQSLFCLNQPCSQHYARCPSGRCI
PETWVCDGDVDCADGGWDETSTNCTDTNGKRVCVGKYLFQCDNSKCISRAFICDGEDDCG
DGSDESTAHSCGNRTCMEDEFNCKSNKHLAQPKYECIPKTWLCDGDVTCVGGEDESEALC
GVAKKACEIPLLKQIIVYTHDCLDGSDEHANCTYQSCQPGLWQCKNHKCIPNSWRCDGNS
DCDDGSDEKQCSTEEISSHNITGLAATSLLSGALNCGASQFECQNGQCIEKQKVCDNNYD
CSDRSDESPSCFVNECEQKEHPLCEQTCVDQVIGYKCSCENGFQINRADNKSCLDIDECL
EGLSLCSHFCGNKQGSYKCSCPEGMTLHPNGFICKANEEHYVRFISLDGSRYELVAQGFE
NLVSMDVDSVDDMVYLLDSGKLRIYRKSLHKLSEAPSSYEQIMRHNVFGIEGIAVDWIGR
KLYSLNRQDRALRVCELDGRFCRTLIRDRISQPKAIVVHPKRGYLYFTEWSLQPYIAKVA
LDGSAPYGTADPVIKIAERDLGWPNALAIDYYSDRLFWGDAHLNELNWMDLQDGIHRRHR
IPAKLTSHIASITVYNEYLFWSDWNLKQVIRADKWTANNESVLVTTLQLPNELRVVHPLR
QPRWPNPCGDNNGGCSHLCLIGAGGSNFSCACPDQFYLLSNGRDCEANCTSRQFACSGTD
SKCISKLWYCDGEKDCTDGDDEPGRDVCGDRICPVGEFQCSNHNCTRPFQMCDGQDDCGD
GSDERDCDKPCDDWMFKCSNTGKCIPKGFTCDGDDDCGDRSDEAEHICKNASRNCTAEEF
RCSNHKCIPKSWKCDSEDDCGDGSDEPKPECDKVECPRGWSRCLNSYRCVPDWAFCNGQD
DCRDGENLSVLVLESAFLSVGYCVDNSDEIDEQCGGTSRPCSESEFRCNEGRCIPHSKVC
DGTIQCSDGLDESQCTLRKCADGYRKCDDGTCILDHKWCDRRRDCVNASDETHCEDYPNR
RHCSPNEYECANSVCISRKFMCDGDNDCGDNSDETNEQCKVAQCDPPLRFRCSHSKLCLN
ILQLCNGFNDCGEHDYSDEHLSMCSSFSEYGDCSTDEFKCTNGKCINATLACDRKDDCGD
ATDEIGCIKQNGKSCHSHSDNGGCRHLCTDVQGGYYCHCRDGFTTDPGNPSDCIDIDECK
GNNTCSQMCLNTKGSYLCKCVDDYTSGVVIGAMNGKDCRANGEHPLIMIASDDKVLQLSL
VGSRGRVNAATRKSPSHQQRSIGAIEFDPRREFMFWLDTYQRKLFRSALPKGNQSHEGQE
LLVNFAENISPLSMAVDYLTGNLYITATVSDLKLNEKSALATAAGRRKKRFSEPLPQPSS
DGNGVIYVTTSDGRYRRTIVAGRLQIPTAIVTLPKLGRICFADAGFEAKIQCADMDGNKR
QTIISDLIYSPTTMAVDEGRDNRIYWSDPKYHKVDSCLPDGSRRLTIARDTRTPWAIDVF
ENHLFWTSGKPINAGTSVSKDSQNLYIQDKFGRSRLQLVASAIDDVHSLRIQQRFARDML
RADSACAKVQCSHLCVELPSDGFRCLCPDGVTQFEDGTCGSARIEELPIPKQCSCQNGGH
CLLDGTCDCGDFEGEFCQKPSSVSRQLIGRFGNGAYYALLLMFAMLVCLAVMTVLSILIY
KRKSVLNKKRLASCEGSSIGGASVVTFHGNVISFSNPVLDADRQIQQQRDNSLVEELHSS
PLKLPQSREMSYIMTTTFTNPVYEHAETLDSFDDDNSSRRTKFENVDTGKINPVFEEKDK
NKH
Download sequence
Identical sequences gnl|MincDB|prot:Minc07096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]