SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gnl|MincDB|prot:Minc08688 from Meloidogyne incognita

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|MincDB|prot:Minc08688
Domain Number 1 Region: 46-119
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.0000000000131
Family Hormone receptor domain 0.0019
Further Details:      
 
Domain Number 2 Region: 134-417
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000449
Family Rhodopsin-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gnl|MincDB|prot:Minc08688
Sequence length 555
Comment length:555 contig:MiV1ctg289 region:23184-27335 strand:-
Sequence
MTLSESATCFKIKDLLNNYNIFNTPLNTAENELTDEVEESEFNYLVQQQSSLCEPDFDRS
LCWYNVSLGSIGQRPCPFQFCKSLPECEFMEQTYTASRYCFENGTWGDSMYGQCIQLLKV
YPQCVAGYCRTCPNLLRDTVIRVSLSLSVVSVCVLLAALVLFSAFDSVQCRRLSIHKNLA
AAFVLRFAILALWTFLNTRNAFQDCSQFAPLHLRQWEWLCKSLLFGLIYFQVASVMWMLI
EGVYLYSRFTVFAMRRSEAPYFVYLFTGWVLPFLVVASWATIHERQSESRSFCWLPYAKG
PHLWILAGTMGMALILNVFLLLLIIIILVRKLRHESSAESRQIWRTVKATMLLVPLLGVS
NVPLFYEPPQPSAFYMLGSAILQHSQGIFIAVLYCFLNAEIQNALKRQISKVPLLRAILS
GGSRESRRQFETERTFIPAGQTDEDLQMSDLPMRCKNGTVRGPRINGKTKQSNSMNAGIN
WHANNNNNNNCKLEENEEVKFEKDYSDFMSTSFLSGTNLINLDENLNERGEGKNKNEEEI
ERRRAESTGSKLRFT
Download sequence
Identical sequences gnl|MincDB|prot:Minc08688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]