SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gnl|MincDB|prot:Minc15756 from Meloidogyne incognita

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|MincDB|prot:Minc15756
Domain Number 1 Region: 45-137
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.000000000000249
Family Hormone receptor domain 0.0041
Further Details:      
 
Domain Number 2 Region: 171-450
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000119
Family Rhodopsin-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gnl|MincDB|prot:Minc15756
Sequence length 596
Comment length:596 contig:MiV1ctg1029 region:16597-20222 strand:-
Sequence
MSSSSSSSTIILYNENPKEASKTTTIINSSPIQLSNGSFVWLNQLNFNLADNMEQCFQAL
TSAGLPIAPNQSSADSVLCWPATQGGQSVTLQCPPLKGLDPSKTITKYCHSSGNWMGKTE
NDFSRPHGWTNFTMCFTREVVAIMQQLDNGTLYEAQEVAKNARKLEFVGLGLSLISLLFC
VAIFTSFRRLRVFRNLLHLHLMIAILAMVLLRLVLYIDLIFTDRLGHQQLVNPQGRTINT
MVFVCELMFFLLEYFKSVAFWWMFLEGLFLHNQLVLAVFNTTPHLWPYLLTGYGVPFIHT
LGWLIILFIKKNGKLERCLGSYYLEVEFWILDGPRLAQLVINTLMLINVIRVLWLKVRDS
RSSSELQRTKKSVKAALMLIPLLGIPNIMQTIPFSPTQDNITYFAIWTYCASFTYMYQGF
MIAIIYCFTNREVQTVLKNCYNRHRLKHSRPLDRHKGGGSHYTQIASKYNNNNNSSSNGI
NNNNDNEKQRGGKLVSGGQIASVDSGERFLFIRSKMIQELEDREGGNNNIKQLNESKNTN
NNNSISSNHQYIKRCSLPINKHKRHPILPSTKIKLKKQLSIHQYQETNNNNIEEEN
Download sequence
Identical sequences gnl|MincDB|prot:Minc15756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]