SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000000018 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000000018
Domain Number 1 Region: 849-1057
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 9.64e-71
Family Complement components 0.000000262
Further Details:      
 
Domain Number 2 Region: 525-594
Classification Level Classification E-value
Superfamily Anaphylotoxins (complement system) 2.35e-20
Family Anaphylotoxins (complement system) 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSMGAP00000000018
Domain Number - Region: 674-725
Classification Level Classification E-value
Superfamily E set domains 0.0021
Family SVA-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000000018   Gene: ENSMGAG00000000634   Transcript: ENSMGAT00000000646
Sequence length 1062
Comment pep:known_by_projection chromosome:UMD2:27:1331:11793:1 gene:ENSMGAG00000000634 transcript:ENSMGAT00000000646 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLCRLFALSRFMQPLLKTVIVEVKTPDNVIIKQVPVSSPKRNGIFSINHNLPEVVSLGTW
TITAKFEDSQDQVFSTQFEVKEYVLPSFEVTLDPQEKFLYIDRQEDFRVFIKARYLYGKN
LQGTAFALFGVMVDDERKTIPQTLQRVKVTDGDGEVVLPMAMLRQRFANLQELVGHSLYV
TVTVLTESGSDMVEAQRSGIRIVTSPYTIHFTHTPKYFKPGMPFDLTVYVTNPDNSPAPR
IPVKADNFQGLVSTQRDGKAKLVLNMPANKNSVPITVRTAQKDLPPERQASQQMVAEAYQ
SQGNSGNYLHLAVGASQVQPGDNLPVNFHLKSNREDVRRSVSYFTYLILSKGHIVHVGRQ
PREGDQSLVTMSLPVTANLIPSFRIVAYYHVKPGEIVADSVWVDVKDTCMGNLVVKGASE
ADNRVHEPRTPMRLRIEGDHKAHVGLVAVDKAVYVLNKNKLTQSQVWDTVEKSDIGCTPG
SGRDHVGVFADAGLSLATNVNIKTEQRGEVECAKPAKRKRRSVKLIKYKGTKMAEYNDRN
LRKCCEDGMKENLMGYSCEKRATYILDGKACTDAFLNCCLYIKGIRDEERDLHYELARSE
ADDAFLADEDITSRSLFPESWLWQVEELTEPPNELGISTKTLPIYLKDSITTWEVLAVSL
SEKKGLCVADPYEITVMKEFFIDLRLPYSAVRNEQVEVRAILYNYWKSKIKVRVELMYNP
ALCSASTSKTRYQQILQLEPQTSHAVPFVIVPLQLGQHDVEVKAAVWESFVSDGVKKKLR
VVPEGMRLEKTVKIVELDPKTLGNNGVQEVKVKAANLSDIVPNTESETKVSIQGNPVSIL
VEKAIDGTKLKHLIVTPSGCGEQNMIGMTPTVIAVHYLDSTMQWETFGINRRAEAIELIK
KGYTQQLAFRKDDGSFAAFTNRPSSTWLTAYVAKVFAMAINMVDIKPEVVCGAIKWLILE
KQKPDGLFQEDAPVIHKEMVGGYHGAEPSVSLTAFVLTALQESQKICKNYVKSLDGSIAK
ASDYLSRKYQSLTRPYTVALSSYALALTRKLNSEKLLMKFSK
Download sequence
Identical sequences G1MPR2
ENSMGAP00000000018 ENSMGAP00000000018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]