SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000000028 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000000028
Domain Number 1 Region: 270-441
Classification Level Classification E-value
Superfamily vWA-like 0.000000000717
Family Integrin A (or I) domain 0.062
Further Details:      
 
Weak hits

Sequence:  ENSMGAP00000000028
Domain Number - Region: 695-770
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 0.0118
Family Terpene synthases 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000000028   Gene: ENSMGAG00000000651   Transcript: ENSMGAT00000000656
Sequence length 797
Comment pep:novel chromosome:UMD2:29:20482:27670:1 gene:ENSMGAG00000000651 transcript:ENSMGAT00000000656 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCSAVVDVAIQDYVADVVSELIYHNESLRSSEVTFVFPLDPHMAIYSFQACSEDAKVKAV
LQDETQWLHKATAEKENFHYLQYGVEKSGEVFACFLGSLSPGKEMVVTLHYVQELSRKPD
GAAQFVLPSTMHPYKTHYSTAQRANVLLYAIFLPTACNCRTDKLHYSLLLTVSLQSPRGV
ADVQANCALTPLIYTAQDHSAAQVSLAGTPPNHHLELLVYYREPTAVSAVVEKGNPAATA
GSLFGDSLVLVTLAPNIPDAKPGLCQSGEFIFVLDSSSLEHTQVPSQSWGQTGVREANDP
MLFLLKSLPLGCYFNIYCYGGTSEGIYPQSVEYTQDNLNEAMQHIPTIGSRLGDTDLLGT
LRTIYNTPRPCGHARQLFIFMSGLPPDKEAIVAEVCRHRNSHRCFSFCFSTDSATLATAL
ARETKGEAIYVSSDNAIVQVLKCLKQALKPVAEGVSLDWTLPSGLEVEVLGGTPQFIFQS
QHIFLYAQIHGKEKNMKEASGVMTLQFSLDGQVLTHKIQFPLCPQGDGRMAGHRLAARYL
LEKLLPEVASGSGDEPMQRAIEISLTSGIICPFTSYVGVRTSRRAPWYHGKERHLGPFPS
LFSKGPWHCCHLASHLFPARSFCYVAPSMVLPAFLRPYGTHLAGTLHCRSHGLPSSNSPM
ALLTYSSKGLTKKDVRRPMGHLAGQKCQGKRDEELVALQNVDGSWTLSSDLASVLQVDEA
EIKGKMPGEVMDPSFWATVLAVTWLQRHNRHCHEIYDLLEAKAVTWLCSQAVSQLDKCLE
ASNTLLGSTVNPSIFRL
Download sequence
Identical sequences G1MPS1
ENSMGAP00000000028 ENSMGAP00000000028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]