SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000000217 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000000217
Domain Number 1 Region: 145-196
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0000405
Family Frizzled cysteine-rich domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000000217   Gene: ENSMGAG00000000835   Transcript: ENSMGAT00000000851
Sequence length 240
Comment pep:novel chromosome:UMD2:11:96800:98074:1 gene:ENSMGAG00000000835 transcript:ENSMGAT00000000851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPPTPLPEAFESFLRLAENHTRSLFEAAYRPMAKEAAEPVKELFTDISLYILGAETTVEN
AVLRFFDSLFPLVYSRLINPGITDLSEDYTECLRLTRQDINPFGHYSKNMVTELSKSLWA
SRMLNQALSLGTEVINTTEHAALTKECSRALVRMQYCPHCQGLTLIRPCVGYCLNVMRGC
LASVSELDMQWREYISTLEYLTNEMGASHDLEIALTGIWNSINEAILHAQLNGPQLSATV
Download sequence
Identical sequences G1MQ74
ENSMGAP00000000217 ENSMGAP00000000217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]