SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000000332 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000000332
Domain Number 1 Region: 313-544
Classification Level Classification E-value
Superfamily Caspase-like 1.42e-35
Family Caspase catalytic domain 0.015
Further Details:      
 
Domain Number 2 Region: 210-281
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000195
Family I set domains 0.013
Further Details:      
 
Domain Number 3 Region: 5-91
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000000392
Family DEATH domain, DD 0.0092
Further Details:      
 
Domain Number 4 Region: 108-189
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000531
Family I set domains 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000000332   Gene: ENSMGAG00000000932   Transcript: ENSMGAT00000000968
Sequence length 701
Comment pep:novel chromosome:UMD2:30:773822:778408:-1 gene:ENSMGAG00000000932 transcript:ENSMGAT00000000968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDWSLPISSLGEEVVAQLCELLDTASRGWRKLAEVAGAEKRFKCSEEELEMCSLKVLEP
LGSPTQSLLQLLAERECSLRYLRGCLHRMGAHTGLPLGSSTVHDVIRITVQPESQVVAEG
TRVSLTCWASGPPGLTYQWFCGKQEVPGATAPELMVDTAAPPGLPQWYICRVSCGAAFAF
SRWAHIQVERSHSPESATASGYCPSMAGLQILQQPQPCHLAEGDPLVLECRALGNPPPQY
QWFRNRRPVEGARGPRLQVQLVTTAERGTYSCRVFNLFHELWSQEVDVEIGEGDLCIPCS
PPYSTLDSPEPGSPDQLYVPAATDKVALLVGNMHYTHHKDLRAPMVDVHALSALLRQLDF
KVVSLLDLRRDEMQMAVDEFLLLLDKGVYGLLYYAGHGYENFGTSFMVPIDAPGSYTSAH
CLCVQHVLQRMQQRRTGLNIFLLDMCRKRNLNDDVLPQVGALEVTANIVFGYATCADAEA
YELSQGELSNGVFVTFLKRWLLEDEKITVLLDKVAEDMGTLELTRGRQALELRSNLSERR
ALTDPIRSLGRAETSARNLQWAKAHVLPESRHLRFDCGVTVQLGFAAEFSNIMIIYTRIL
ATPGDITECVAKLTDLPEELDVDLKYTNRESPEELGSPLVPTWSLTCPSCCLYSRLCGLQ
RLRQELTFTVCLQFRYRGVADFVEERRAVSVGRPLIAKLNL
Download sequence
Identical sequences G1MQH7
ENSMGAP00000000332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]