SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000000422 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000000422
Domain Number 1 Region: 132-353
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-62
Family DBL homology domain (DH-domain) 0.0000000621
Further Details:      
 
Domain Number 2 Region: 338-495
Classification Level Classification E-value
Superfamily PH domain-like 2.89e-50
Family Pleckstrin-homology domain (PH domain) 0.00000127
Further Details:      
 
Domain Number 3 Region: 40-164
Classification Level Classification E-value
Superfamily SH3-domain 3.28e-25
Family SH3-domain 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000000422   Gene: ENSMGAG00000001021   Transcript: ENSMGAT00000001059
Sequence length 556
Comment pep:known_by_projection chromosome:UMD2:11:1100319:1135610:1 gene:ENSMGAG00000001021 transcript:ENSMGAT00000001059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VIADGALDKTALTDDVGSEEDLYEDFRSSNHRYGHPGGGGEQLAINELISDGSVVYAEAL
WDHVTMDDQELGFKAGDVIEVMDATNKEWWWGRILDSEGWFPASFVRLRVNQDEPLEDYP
VKVEGGKDDDSSSGTRRFGMGQTTKDQMRTNVINEIISTERDYIKHLKDICEGYIKQCRK
RADMFTEEQLKTIFGNIEDIYRCQKKFVKALEKKFNKDHPHLSEVGSCFLEYQTEFQIYS
EYCNNHPNACMELSRLTKVNKYVYFFEACRLLQKMIDISLDGFLLTPVQKICKYPLQLAE
LLKYTNPQHRDFKDVEAALNAMKNVARLINERKRRLENIDKIAQWQSSIEDWEGEDVLVR
SSELIYSGELTKVSHPQAKSQQRMFFLFDHQLVCCKKDLLRRDILYYKSRINMDDMEILD
VEDGKDKDFSISVKNAFKLHCRDTEEVHLFCAKKPEQKQRWLKAFENERRQVQLDQETGF
SITEMQKKQAMLNASKQHHTGKPKAVTRPYYDFLMRQKHPTLPTTLPQQQVFMLAEPKRK
PSNFWQNISRLTPFRK
Download sequence
Identical sequences G1MQQ3
ENSMGAP00000000422 ENSMGAP00000000422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]