SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000000441 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000000441
Domain Number 1 Region: 707-787
Classification Level Classification E-value
Superfamily E set domains 5.74e-21
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000702
Further Details:      
 
Domain Number 2 Region: 889-998
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000606
Family Ankyrin repeat 0.0035
Further Details:      
 
Weak hits

Sequence:  ENSMGAP00000000441
Domain Number - Region: 1352-1463
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000451
Family Motor proteins 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000000441   Gene: ENSMGAG00000001017   Transcript: ENSMGAT00000001080
Sequence length 1513
Comment pep:known_by_projection chromosome:UMD2:23:291021:329590:-1 gene:ENSMGAG00000001017 transcript:ENSMGAT00000001080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NPDIVLVHYLNVPAIEDCGKPCGPILCSINTDKKEWAKWTKEELIGQLKPMFHGIKWTCS
NGNSSSGFSVEQLVQQILDSHQTKPQPRTHNCLCTGTLGTGAGSSVHHKCNSAKHRIISP
KVEPRTGGYSTHSEVQNNDVSEGKNEHSHGKASSREKRNGKVAKPVLLHQNSTEVSSTNQ
VEVPDTTQNSPVSISSGLNSDPDMADSPAVTGVSSMAVASVMGSLSQSATVFMSEVTSEA
VYTMSPTSGPNQHLLSSDAAAQGLVLAVSSDGHKFAFPTTASSESLSMLPSTVSEELVLS
TTLDGNRKIPETTMNFDPDCFLNNPKQGQTYGGGGMKGDSISTNIRQSPTTERSFNFNTT
LTKEIKTEDTSFEQQMSKEAFSSTSASNTLTLTTGSGLLPSGGGLSPSTTLEQMDFSAID
SNKDYSSSFNQTVQSPHVHQTPSPSFFLQDASKPLPLEQNTHNNLNDTSGSFVNTIGIPS
VKTESPSQTTSNCNGTVETRIESTSSLQLMQFQANFQAMTAEAEVPMETSQQAEGNENLL
KSGDLQACSTEHYLQPETNGGIRNGNNLPILQGNMVQGLYPVAHPSLNNSSNMELNLDHF
DISFSNQFSDLINDFISVEGGSNALYGHQLVSGDSAGLSQPEDSNRTTYNQAEMCIPCCS
PQQANMQLSSTENGASTMAYMHVAEVVSAAAAQGTLGLLQQSGRLFMVTDYSPEWSYPEG
GVKVLITGPWQEASNNYSCLFDQISVPASLIQPGVLRCYCPAHDTGLVTLQVAFNNQIIS
NSVVFEYKARALPTLPSSQHDWLSLDDNQFRMSILERLEQMERRMAEMTGSQQHKQGVGG
GSNGSGNGGTQVQCVSGTGTLGSCFESRVVVVCEKMMSRACWAKSKHLIHSKTFRGMTLL
HLAAAQGYATLIQTLIKWRTKHADSIDLELEVDPLNVDHFSCTPLMWACALGHMDAAVVL
YKWDRRAISIPDSLGRLPLAIARSRGHVKLAECLEQLQRDEQTQLGQNPRIQCPSSTDSS
PENWVSQWHSELIASQEPQKGVTVISSTNTELRRPRSEPSSYYSSETQKDYPAPKKHKLS
PEYFQARQEKLLSTALSLEQPSVRKQNSSSKQSTTETISPSEGIRDYGRELSQHIPEAAG
YRGSGSQAGIKWNPKDIYIGVSAVQLVGSQKSPALGKDAVGHRLRQREQMNVLMLADREL
VDAELLSYRDNVGDEDCLRHMDDLQVNMMTLAEHIIEATPDRIKRENFVPMESPQVERAE
SAAMSTTMSWLASYLADVDHLPSAAQIRSVNLYSEPLTPSSNTSLSPAGSPISEIAFEKP
SLPSAADWSEFLSASTSEKVENEFAQLTLSDHEQRELYEAAKLVQTVFRKYKGRPLREQQ
EVAAAVIQRCYRKYKQLTWIALKYALYKKMTQAAILIQSKFRSYYEQKKFQQSRRAAMLI
QQYYRSYKECGKRRQNRRTATIVQQKLRSSLLTKKQDQAARKIMRFLRRCRHSPLVDHRL
YKRSERIEKGQGT
Download sequence
Identical sequences G1MQR7
ENSMGAP00000000441 ENSMGAP00000000441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]