SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000000495 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000000495
Domain Number 1 Region: 6-62
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000005
Family DEATH domain, DD 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000000495   Gene: ENSMGAG00000001103   Transcript: ENSMGAT00000001136
Sequence length 73
Comment pep:novel scaffold:UMD2:GL429732.1:66473:66691:1 gene:ENSMGAG00000001103 transcript:ENSMGAT00000001136 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YQFLCNASEREVAAFSNGYTADHERAYAALQHWTIRGPEASLAQLISALRQHRRNDVVEK
IRGLMEDTAAVRL
Download sequence
Identical sequences H9H059
ENSMGAP00000000495 ENSMGAP00000000495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]