SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000000525 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000000525
Domain Number 1 Region: 2-96
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 7.72e-32
Family Frizzled cysteine-rich domain 0.0000904
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000000525   Gene: ENSMGAG00000001120   Transcript: ENSMGAT00000001167
Sequence length 492
Comment pep:known_by_projection chromosome:UMD2:21:242857:244690:-1 gene:ENSMGAG00000001120 transcript:ENSMGAT00000001167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XNLLGHESQREAALKLHEFAPLVEYGCHVHLRFFLCSLYAPMCTDQVSASIPACRPMCEQ
ARHKCVPIMEQFNFGWPESLDCGRLPTKNDNALCMEAPENASAAEPHKGQGMLPVAPRPW
PPGSAEGRGPNGLGACDNPEKFQYVEKSLSCAPRCSPGVDVYWSREDKNFAFVWMAVWST
LCFVSTAFTVLTFLLDPHRFQYPERPIIFLSMCYNVYSVAFIIRSVAGAENIACDRENGE
LYIIQEGLESTGCTIVFLILYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEAHSSYFHM
AAWGIPAMKTIVILTMRKVAGDELTGLCYVGSMDVSALTGFVLIPLSCYLVVGTSFILTG
FVALFHIRKIMKTGGTNTEKLEKLMVKIGVFSILYTVPATCVIVCYFYERLNVDYWNLRA
LEASVPTVAVFMLKIFMSLVVGITSGVWVWSSKTLQTWQSLCNRKLGVRTRGKPCSGGGS
WGRGRKGNNPVR
Download sequence
Identical sequences G1MQY1
ENSMGAP00000000525 ENSMGAP00000000525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]