SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000000582 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000000582
Domain Number 1 Region: 496-755
Classification Level Classification E-value
Superfamily NHL repeat 9.94e-48
Family NHL repeat 0.00000846
Further Details:      
 
Domain Number 2 Region: 346-442
Classification Level Classification E-value
Superfamily E set domains 1e-22
Family Filamin repeat (rod domain) 0.0032
Further Details:      
 
Domain Number 3 Region: 120-183
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000137
Family B-box zinc-binding domain 0.0023
Further Details:      
 
Domain Number 4 Region: 29-103
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000052
Family RING finger domain, C3HC4 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000000582   Gene: ENSMGAG00000001098   Transcript: ENSMGAT00000001224
Sequence length 757
Comment pep:known_by_projection chromosome:UMD2:4:88963:138514:1 gene:ENSMGAG00000001098 transcript:ENSMGAT00000001224 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KETGPICQWSRMASEGSNIPSPVVRQIDKQFLICSICLDRYKNPKVLPCLHTFCERCLQN
YIPAHSLTLSCPVCRQTSILPEKGVSALQNNFFITNLMDVLQRTPENSIEESSILETVTA
VAAGKPLSCPNHDGNVMEFYCRSCETAMCRECTEGEHAEHPTVPLKDMVEQHKASLQVQL
DSVNKRLPEIDSALHFISEIIHQLTNQKASIVDDIHSTFDELQKTLNVRKSVLLMELEVN
YGLKHKVLQTQLDTLLEGQESIKSCSNFTAQALNHGTETEVLLVKKQKQMSDKLNELAER
DFPLQPRENDQLDFIVETEGLKKSIHNLGTILTTNAVASETVATGEGLRQTVIGQPMSVT
ITTKDKDGELCKSGNAYLTAELSTPDGSVADGEILDNKNGTYEFLYTVQKEGDFTLSLRL
YDQHIKGSPFKLKVVRSADVSPTTEGVKRRVKSPGSGHVKQKAVKRPASMYSTGKRKENP
IEDDLIFRVGTKGRNKGEFTNLQGVAASTNGKILIADSNNQCVQIFSNDGHFKSRFGIRG
RSPGQLQRPTGVAVHPGGDIIIADYDNKWVSIFSSDGKFKAKIGSGKLMGPKGISVDRNG
HIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDKQFAGPHFAAVNSNNEIIVTDFHNHSVK
VFNQDGEFILKFGSNGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQVFDGSGSFLSYIN
TSADPLYGPQGLALTSDGHVVVADSGNHCFKVYRYLQ
Download sequence
Identical sequences G1MR29
ENSMGAP00000000582 ENSMGAP00000000582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]