SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000000662 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000000662
Domain Number 1 Region: 82-348
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 5.99e-30
Family FolH catalytic domain-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000000662   Gene: ENSMGAG00000001222   Transcript: ENSMGAT00000001307
Sequence length 516
Comment pep:known_by_projection chromosome:UMD2:30:731605:761398:-1 gene:ENSMGAG00000001222 transcript:ENSMGAT00000001307 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TRSAVLNTEARTVEADVLSRRCVMMRLLDFSYEQYQKALRQSAGAVVIILPRSISSVPQD
VVKQFMEIEPEMLAMETIVPVYFAVEDDELLSIYEQTRAASASQGSASAAEVLLHTATAN
GFQMVTSGAQSKAIHDWLIPSVEGRLTGLGGEDLPTVVIVAHYDSFGVAPWLSHGADSNG
SGVSVLLELARLFSRLYTYRRTHAGYNLLFFASGGGKFNYQGTKRWLEDNLDHTDSSLLQ
DNVAFVLCLDTLGQGNSLHLHVSKPPKEGTLQHAFLRELEMVVASQFPEVKFSMVHKKIN
LAEDMLAWEHERFAIRRLPAFTISHLESHRDSLRNSIMDRRQSWDGEENMGSWALGSQVD
TKALTRNTRIIAEALTRVIYNLTEKGAPADLQIFTDQMQIQEEQLESVMDWLSSQPRAAQ
LIDKDSTFLSTLEYYMGRYLKDVKQHHVKADKRDPEFVFYDQLKQVMNAYRVKPAIFDLL
LAVCIAAYLGVAYVAVQNFGLLYRMIQRLSLKTKQQ
Download sequence
Identical sequences G1MR79
ENSMGAP00000000662 ENSMGAP00000000662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]