SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000000720 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000000720
Domain Number 1 Region: 41-158
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 2.88e-39
Family Frizzled cysteine-rich domain 0.0000594
Further Details:      
 
Domain Number 2 Region: 175-283
Classification Level Classification E-value
Superfamily TIMP-like 0.0000000000000314
Family Netrin-like domain (NTR/C345C module) 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000000720   Gene: ENSMGAG00000001285   Transcript: ENSMGAT00000001366
Sequence length 297
Comment pep:known_by_projection chromosome:UMD2:4:347633:350516:-1 gene:ENSMGAG00000001285 transcript:ENSMGAT00000001366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAHRPAMPRRLCALFLLASQCLGSAAGLFPFGEPDFSYKRSNCKPIPAPMLLCRGIEYQS
MRLPNLLGHETVQEVLEQASTWIPLVQKQCHPDTRKFLCSLFAPVCIDDLDEIIQPCHSL
CEEVKESCAPVMSAFGFPWPDMLDCSRFPKDNDLCIPLASSDHILPVTREAPKVCDACKN
KNEDDNDIMENLCKNDFALKIKVKEIAYINGDTKITPETKSKTIYKLNGLTERDLRKIVL
WLKGGLQCTCDEMNDINVPYLVMGQKQAGELVITSLKRWQKGQRFKRFSRSIRKLQC
Download sequence
Identical sequences G1MRC5
ENSMGAP00000000720 ENSMGAP00000000720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]