SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000000773 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000000773
Domain Number 1 Region: 387-609
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.15e-52
Family DBL homology domain (DH-domain) 0.0001
Further Details:      
 
Domain Number 2 Region: 614-743
Classification Level Classification E-value
Superfamily PH domain-like 2.19e-27
Family Pleckstrin-homology domain (PH domain) 0.0032
Further Details:      
 
Domain Number 3 Region: 149-236
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000672
Family Ras-binding domain, RBD 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000000773   Gene: ENSMGAG00000001336   Transcript: ENSMGAT00000001419
Sequence length 835
Comment pep:known_by_projection chromosome:UMD2:23:567559:577606:1 gene:ENSMGAG00000001336 transcript:ENSMGAT00000001419 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTSALVPAGVPRAAWSLLSPADEQRPAEEQGLRCQNPDCTDKRRAAKVCHHAECQQLNCS
SPLSLCEACDGHLHDTMHFDGHIRFDLPPPGSILARNVSTRSCPPRTSPASDMEDDDEGQ
ADGRGDKRSSALKLPKKKARRRHTDDPSKECFTLKFDLNVDIEAEIVPAMKKKSLGDVLL
PVFERRAIEHSKVDIYLDQSNTPLSLQFEAYRFGGHYLRVKAKPGDELKVEQAARDARSA
SLPILRPASTAALLGTGLEPGPGRREGTDILAPGRRRKNMTEFLGPASPSPEPSLHGSGS
LPTNGTDTWKNRAASRFSGFFSSGASTGPFGREVDKMEQLESKLHTYSSFGLPKLPPQLR
FDQDSWEEDGDDSSLVLEDSWQQIIEGTEALTRRQCHQQEAIWELLHTEATYIRKLKVIT
DLFLCCLLNLQESGLLCEVDAERLFGNIGEIIQLHRSLWSSVMAPVLDKARRTKVLLDPM
DFLKGFKTFGTLFKPYIQYCMEEEGCMEYMRNLLRDSELFRAYVTWAEKHKQCSRLKLSD
MLVKPHQRLTKYPLLLKSVLKKTDDARTRDAILTMIGSVEHFINHVNSRMRQRQEQQRLA
AILSRIDAYEVVEGSTDEVDKLLKEFLRLDLTAPMPGTSPDDTRQLLLEGSLKMREGKDS
KMDVYCFLFTDLFLITKPVKKAERTKVIRQPLLVDKVICRELKDPGSFLLIYLNEFGSAV
AAYTFQASGQSLCRSWVEALHNAQVKTLCGEDVGLPGPGAGSSSSGDSTSELSEPEEPME
TPGPTLGQPGHSPQPPAHRTLSDSSSAQHRKLTLAQLYRIRTTLLLNSTLTASYV
Download sequence
Identical sequences G1MRG3
ENSMGAP00000000773 ENSMGAP00000000773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]