SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000000903 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000000903
Domain Number 1 Region: 5-175
Classification Level Classification E-value
Superfamily E set domains 2.17e-79
Family Arrestin/Vps26-like 0.000000148
Further Details:      
 
Domain Number 2 Region: 178-362
Classification Level Classification E-value
Superfamily E set domains 5.6e-62
Family Arrestin/Vps26-like 0.000000387
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000000903   Gene: ENSMGAG00000001385   Transcript: ENSMGAT00000001551
Sequence length 395
Comment pep:known_by_projection chromosome:UMD2:9:1186079:1193258:1 gene:ENSMGAG00000001385 transcript:ENSMGAT00000001551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEGSKVFKKTSPNGKLSIYLGKRDFVDHVESVDAVDGVCLIDPEYLKDRKVYVTLTCAF
RYGRDDLDVIGLTFRKDLYVLTTQIFPPVPEQVPKTLTPLQEKLLKKLGENAYPFTFEIA
TNLPCSVTLQPGPDDVGKACGVDFEVKGFCAENLEEKIHKRNSVRLVIRKIQFAPLKTGP
GPKSETTRQFMMSDKPLHLEATLEKEIYYHGEPINVTVNINNTTNKIVKKIKIAVDQITD
VVLYSLDKYSKTVCMEEINETVAANSTFSKTYSVTPTLSANREKRGLALDGKLKHEDTNL
ASTTILRPGMDKEVLGILVSYKVKVNLVVSRGGILGDLTSSDVGVELPVILMHPKPVDGK
PSNPERVIGFSWSNFKLEGNREDGFLEDESFTETG
Download sequence
Identical sequences G1MRQ8
ENSMGAP00000000903 ENSMGAP00000000903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]