SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000000925 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000000925
Domain Number 1 Region: 44-770
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.36e-251
Family Motor proteins 0.000000000249
Further Details:      
 
Domain Number 2 Region: 1957-2058
Classification Level Classification E-value
Superfamily Second domain of FERM 7.59e-21
Family Second domain of FERM 0.0021
Further Details:      
 
Domain Number 3 Region: 2059-2149
Classification Level Classification E-value
Superfamily PH domain-like 1.57e-19
Family Third domain of FERM 0.014
Further Details:      
 
Domain Number 4 Region: 1335-1428
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000000196
Family Second domain of FERM 0.0063
Further Details:      
 
Domain Number 5 Region: 1847-1920
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000196
Family Ubiquitin-related 0.074
Further Details:      
 
Domain Number 6 Region: 1557-1608
Classification Level Classification E-value
Superfamily SH3-domain 0.0000415
Family SH3-domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000000925   Gene: ENSMGAG00000001337   Transcript: ENSMGAT00000001573
Sequence length 2158
Comment pep:known_by_projection chromosome:UMD2:11:2131662:2176567:-1 gene:ENSMGAG00000001337 transcript:ENSMGAT00000001573 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVFRKGDHVWLEAHPNSEFNVPIGAVVKDSDSGRILLEDDEGKEHWITARNMHMVRPMD
PSTAQGVEDMIRLGDLHEAGMVHNLLIRHQQHKIYTYTGSILVAVNPYQLLPLYTVDLIR
LYCNKRIGELPPHVFAIADNCYFNMKRNKRDQCCVISGESGAGKTAGSTRLIRDIEHIWI
TRKSVIKVLSVLFPSAFGNAKTIRNDNSSRFGKYIDIYFNHSGVIEGARIEQFLLEKSRV
CRQAPEERNYHIFYCMLMGMNAEQKKMLNLGTASEYTYLTMGNCTSCDSRNDTKEYAHIR
SAMKILMFSDSEHWDISKLLATILHLGNVEFEAAVYDNLDCSDVMDSPHFSIATKLLEVD
YSELQNSLTNLSIIVRGESVSRPLNVAQAADGRDAFVKGIYGRIFLWIVNKINSAIFNPT
SQKPKNTRQSIGLLDIFGFENFSNNSFEQLCINIANEHLQQFFVHHVFKLEQEEYLAEHI
TWNNIDFTDNRQALEVIALKPMNIISLIDEESKFPKGTDATMLIKINSLHGKSRVYIPPK
SDHDTKFGINHFAGAVFYESKDFLEKNRDTLSANVMQVVHSSKNKFLKEIFQQTACAYSS
QGLDTTKRLSTLGGQFKQSLEKLMKILGQCQPYFIRCIKPNDYKKPLLFDRELCIKQLRY
SGMMETIRIRKAGYPVRYTFEEFFERYRVLLPRSALEPVKNDARQCCIRISEAVLGKDES
WQAGKTKIFLKDYHDTILELERQKILTDKVLLIQKVMRGFKDRSVMLQKNAGLLHMQWRS
SCCGYSHTYKIMLGFGRLQALYRSRQLAKQYEAARAHIIRFQAACRGYLIRQKVAAQMKA
VSVTYRHRQGACLLARLHKQGHLENKVKLEARNIRLEEEERLISILGPVKAREEAMKLEK
EHLATLEEKEEEEGQRMNNDFVDRHTNYDVISDQEMVDKIFGFLPSMIGGQEGQAPLGFE
DLETKPSKLEEVDLDMIPMSVELEEEADGLEDYTFPKFAATYFQGSSTHTHIRKPLRHPL
LYHDDKDNVLASLVVWVIILRFMGDLPEPTMFAKNATKSGSMMTQIYDTLGRKNQVQFKN
DSPDMRESKKDNKISKGISSLKLKRSSKLTGKVTDQLKSGEEGFQEDSSISERPMSNLEK
VHFIIGNAILRPAIRDEIYCQICKQLTENSSRSSYARGWILLSLCLGCFPPSDTFVKYLL
NFIHNGPSGYAPYCAERLRRTYVNGARTEPPSWLELQVTFLFARVMLPCPFLYMSALVLL
IFPSSTPRHKNTHNYQSVTSTSIYSAFQILIFLCWEVWSLGGGRDHVLDAISQCEQLVKE
RGTHERHAPWRLYFRKEIFTPWHNSQEDPISTDLIYHQVIRGIRFGEYRCEKEEDLVEIG
AKYCYIQFGDTIHNELVQKVLHDCIPVKQLKSKPLEKWVSLITYAHAKAPYTQDRLSRQA
VKEQLVDFARFQWPLLFSRFFEVTKFSGPSLPKNHFILAVNWKGICFLDESEKRLLELTF
PEITGIHTNRAVKSFGQSCTLITLRAEEFVLTSVNSIVIAELVVMFLEGLKKRSRFAVAM
HEKKSQEDPAILSFKKGDLLILTEDKRLDANSGWIYAQNDRTGKTGNVFLEEMYIIPSLT
KPSSQVLSLLMMSPDQRRTASQNSYIEEPDEEDLKVKPYTLEEFSYEHFRTPEKESISKA
VLQKSRGHSQLWAHSKDPLKQPLLKAACTDPDVRDVACQAFIARSPIMKFMGDYPSKQTH
SSVEVTDQIFVAAIKEEVLRDEIYCQIMKQLTENRNRYSVTKGWQLLWLCTGLFPPSKSL
LKHAQKFIETRQKEPLALECKRRIQTVMRSGSRKWAPHPVEVEAILQNNTKISHKICFPN
ETEQTFDVGTNTKNRTLCQNIASKLQLSSWEGFSLFVKIADKVISQNEADYFFDSLRQLT
DWTKRNKPVKDVTVPWSSETAFFVGWFILTPGKDLKADSIFHYHQELPKYLRGYHNCSRD
EAVQLAGLIYKVRFNNDRTQLATIPKILKELVPDNLLRVTSPDEWKKSITAAYSKHEGKT
VDEAKIAFLKIIYRWPTFGSAFFEVKQTSEPNFPEIVLIAINKQGVSVIHQKTKEILTVY
PFNKISNWSSGSTFFHMTIGNLVRGSRILCETSLGYKMDDLLTSYVHLLMNAVNKQKS
Download sequence
Identical sequences G1MRS5
ENSMGAP00000000925 ENSMGAP00000000925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]