SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000001035 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000001035
Domain Number 1 Region: 138-540
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 3.14e-111
Family Terpene synthases 0.0000000000742
Further Details:      
 
Domain Number 2 Region: 2-197
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.78e-66
Family Terpene synthases 0.0000000209
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000001035   Gene: ENSMGAG00000001544   Transcript: ENSMGAT00000001684
Sequence length 575
Comment pep:known_by_projection chromosome:UMD2:7:429452:437127:1 gene:ENSMGAG00000001544 transcript:ENSMGAT00000001684 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAGGAVGIPSWGKFWLAVLNVYSWEGMNTLLPEMWLLPTWFPAHPSRLWCHCRQVYLPMS
YCYAKRLSAEEDELIRSLQQELYVQDYASIDWPAQRNNVAACDVYTPHSWLLGIAYAVMN
VYEAHHSTYLRQRAIMELYDHIKADDRFTKCISIGPISKTINMLVRWFVEGENSPAFKEH
VSRIPDYLWLGLDGMKMQGTNGSQLWDTAFAIQAFLEAEAQKIPEFMSCLQNAHEFLRFT
QIPENPPDYQKYYRHMNKGGFPFSTRDCGWIVADCTAEGLKSIMLLQEKCPFIANPVAAE
RLFDAVNVLLSMRNSDGGFATYETKRGGHLLELLNPSEVFGDIMIDYTYVECTSAVMQAL
RHFQNVYPEHRAPEIRETLQKGLDFCRKKQRDDGSWEGSWGVCFTYGTWFGLEAFASMQH
VYRDGVACREVARACQFLLSKQMTDGGWGEDFESCEQRTYVQSSSSQIHNTCWALLGLMA
VRYPDTGVLERGIKLLIDKQLPNGDWPQENIAGVFNKSCAISYTAYRNVFPIWTLGRSLG
CIPTALLLSTCNPDPWLGWGRLQRQHCLIELMPWL
Download sequence
Identical sequences G1MS13
ENSMGAP00000001035 ENSMGAP00000001035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]