SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000001036 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000001036
Domain Number 1 Region: 145-336
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.07e-86
Family p53 DNA-binding domain-like 0.000000665
Further Details:      
 
Domain Number 2 Region: 524-589
Classification Level Classification E-value
Superfamily SAM/Pointed domain 3.71e-20
Family SAM (sterile alpha motif) domain 0.00002
Further Details:      
 
Domain Number 3 Region: 372-412
Classification Level Classification E-value
Superfamily p53 tetramerization domain 0.00000000000432
Family p53 tetramerization domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000001036   Gene: ENSMGAG00000007535   Transcript: ENSMGAT00000001685
Sequence length 660
Comment pep:known_by_projection chromosome:UMD2:11:13929820:14014935:-1 gene:ENSMGAG00000007535 transcript:ENSMGAT00000001685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RFVETPSHFSWKESYYRSAMSQSSQPREFLSPEVIQHIWDFLEQPICSVQPIDLNFIDDP
SENGPTNKIEISMDCVRLQDTELTDPMWPQYTNLGLLNSMDQQIQNGSSSTSPYNTEHAQ
NSVTAPSPYAQPSSTFDALSPSPAIPSNTDYPGPHSFDVSFQQSSTAKSATWTYSTELKK
LYCQIAKTCPIQIKVMTPPPQGAVIRAMPVYKKAEHVTEVVKRCPNHELSREFNEGQIAP
PSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCVGGMNRRP
ILIIVTLETRDGQVLGRRCFEARICACPGRDRKADEDSIRKQQVSDSTKNGDGTKRPFRQ
GTHGIQMTSIKKRRSPDDELLYLPVRGRETYEMLLKIKESLELMQYLPQHTIETYRQQQQ
QQHQHLLQKQTSIQSQSSYGSNSPPLSKMNSMNKLPSVSQLINPQQRNALTPTTIPDGMG
TNIPMMGTHMAMTSDMNGLSPTQALPPPLSMPSTSHCTPPPPYPTDCSIVSFLARLGCSS
CVDYFTTQGLTTIYQIEHYSMDDLVSLKIPEQFRHAIWKGILDHRQLHDFSSPPHLLRTP
SGASTVSVGSSETRGERVIDAVRFTLRQTISFPPRDEWNDFNFDMDARRNKQQRIKEEGE
Download sequence
Identical sequences G1MS14
ENSMGAP00000001036 ENSMGAP00000001036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]