SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000001059 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000001059
Domain Number 1 Region: 3-168
Classification Level Classification E-value
Superfamily p53-like transcription factors 6.46e-73
Family p53 DNA-binding domain-like 0.00000123
Further Details:      
 
Domain Number 2 Region: 350-416
Classification Level Classification E-value
Superfamily SAM/Pointed domain 9.16e-23
Family SAM (sterile alpha motif) domain 0.0000302
Further Details:      
 
Domain Number 3 Region: 208-248
Classification Level Classification E-value
Superfamily p53 tetramerization domain 0.00000000000196
Family p53 tetramerization domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000001059   Gene: ENSMGAG00000001562   Transcript: ENSMGAT00000001710
Sequence length 495
Comment pep:known_by_projection chromosome:UMD2:23:934962:941215:-1 gene:ENSMGAG00000001562 transcript:ENSMGAT00000001710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLLFQYSPLLKKLYCQIAKTCPIQIKVSSPPPPGTIIRAMPVYKKAEHVTEVVKRCPNHE
LGRDFNDGQSAPASHLIRVEGNNLSQYVDDPVTGRQSVMVPYEPPQVGTEFTTILYNFMC
NSSCVGGMNRRPILIIITLETRDGQVLGRRSFEGRICACPGRDRKADEDHYREQQALNES
AAKNGNANKRTFKQSPQAIPALGPGVKKRRHGEEEMYYVPVRGRENFEILMKIKESLELV
ELVPQQLVDSYRQQQQQLLQRQNQLQTPSSYGPVLSPMNKVHGGGINKLPSVNQLVGQPA
QHSSGSASSLGPMGPGMLNSHPMQPNGEMNGGHSSQSMVSGSHCTPPPPYNPDPSLVSFL
TGLGCPNCIDYFTSQGLQNIYHLQNLSIEDLGALKIPEQYRMIIWRGLQELKQSHDYGAQ
QLIRSSSNASTISIGSSGELQRQRVMEAVHFRVRHTITIPNRGAADEWADFGFDLPDCKS
RKQSIKEEFTEGEIN
Download sequence
Identical sequences G1MS29
ENSMGAP00000001059 ENSMGAP00000001059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]