SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000001071 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000001071
Domain Number 1 Region: 268-398,713-886
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 3.05e-50
Family Diacylglycerol kinase-like 0.026
Further Details:      
 
Domain Number 2 Region: 2-123
Classification Level Classification E-value
Superfamily PH domain-like 3.48e-30
Family Pleckstrin-homology domain (PH domain) 0.0054
Further Details:      
 
Domain Number 3 Region: 1094-1160
Classification Level Classification E-value
Superfamily SAM/Pointed domain 9e-19
Family SAM (sterile alpha motif) domain 0.0044
Further Details:      
 
Domain Number 4 Region: 169-238
Classification Level Classification E-value
Superfamily Cysteine-rich domain 8.67e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000284
Further Details:      
 
Domain Number 5 Region: 109-165
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000464
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000001071   Gene: ENSMGAG00000001549   Transcript: ENSMGAT00000001722
Sequence length 1167
Comment pep:known_by_projection chromosome:UMD2:11:2228425:2267628:-1 gene:ENSMGAG00000001549 transcript:ENSMGAT00000001722 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TVIKEGMLMKQTSSFQRWKRRYFKLRGRTLYYAKTAKSIIFDEVDLTDASVAESSTKNVN
NSFTIITPCRKLILCADNRKEMEDWIAALKTVQNREHFESTQYSMDHFSGMHNWYACSHA
RPTYCNVCREALSGVTSHGLSCEVCKFKAHKRCAVRATNNCKWTTLASIGKDIIEDEDGI
SMPHQWLEGNLPVSAKCTVCDKTCGSVLRLQDWRCLWCKAMVHTACKELLPSKCPLGLCK
VSVIPPTALNSIDSDGFWKATCPPSCTSPLLVFVNSKSGDNQGVKFLRRFKQLLNPAQVF
DLMNGGPHLGLRLFQKFDTFRILVCGGDGSVGWVLSEIDSLNLHKQMQCQLGVLPLGTGN
DLARVLGWGSACDDDTQLPQILEKLERASTKMLDRWSIMVYETKLPRQASSSTVTEDFSE
DSEVQKILFYEDSVAAHLSKILTSDQHSVVISSAKVLCETVKDFVARVGKAYEKATESSE
ESEVMARKCSVLKEKLDSLLKTLNDESQASSSLPPPPTIAEETEDGDGSGSACDSSSERS
VGSSCTARPQIFRPREQLMLRANSLKKAIRQIIEHAEKAVDEQNAQTQEQEGFLLSLSAS
EEGKELRNEDKISLQSSHSSSYGLSKGRSQRKASKSPCERQISKGSLSLGSSASLPPQTG
NRDNLPMLNTKILYPNIRAGMSGSLPGSSVISRLLIHADPFNSEPENLECYTEKCVMNNY
FGIGLDAKISLDFNNKRDEHPEKCRSRTKNMMWYGVLGTKELLHRTYKNLEQKVLLECDG
RPIPLPSLQGIAVLNIPSYAGGTNFWGGTKEDDTFTAPSFDDKILEVVAVFGSMQMAVSR
VINLQHHRIAQCRTVKIAILGEEGVPVQVDGEAWIQPPGYIWIVHKNRAQTLTRDRAFES
TLKSWEDKQKCELSRPSSFSLQPEIMSEEESTQINQFGQTAGALIHSIREIAQSYQDMEQ
ELAHAVNASSKSMDKVYAKSKSTEGLNCSLVVEMVNNVKALHNETELLLAGKMALQLDPP
QKEQLQAALADMDLQLRKLAYIPWLWQLMEPCDEENQMLDYSKRSRSGKFRLVTKFKKEK
NNKNKETHSSMGLPVHLWGTEEVAAWLEHLSLCEYKDIFIRHDVRGSELLHLERRDLKDL
GVTKVGHMKRILHGIKELSRSTPASEV
Download sequence
Identical sequences G1MS39
ENSMGAP00000001071 ENSMGAP00000001071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]