SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000001155 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000001155
Domain Number 1 Region: 97-440
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.63e-67
Family Pancreatic carboxypeptidases 0.00000383
Further Details:      
 
Domain Number 2 Region: 2-77
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.96e-24
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0017
Further Details:      
 
Domain Number 3 Region: 441-507
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 6.28e-17
Family Carboxypeptidase regulatory domain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000001155   Gene: ENSMGAG00000001647   Transcript: ENSMGAT00000001806
Sequence length 521
Comment pep:known_by_projection scaffold:UMD2:GL424282.1:48:4534:1 gene:ENSMGAG00000001647 transcript:ENSMGAT00000001806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SCSEDFVTSFYVGFSNDSQNWVMYTNGYEEMKFYGNVDKDTPVLTEFPEPMVARYIRVYP
QTWNGSLCLRLEVLGCPLSPVSSYYAQQNEVTSADNLDFRHHSYKDMRQLMKVVNEECPT
ITRIYNIGKSSRGLKIYAMEISDNPGEHETGEPEFRYTAGLHGNEALGRELLLLLMQFLC
KEYQDGNPRVRSLVTETRIHLVPALNPDGYELAQEAGSELGNWALGHWTEEGFDLFENFP
DLTSPLWAAEERQLVPHRFPGHHIPIPEHYLQDAAAVAVETRAVMAWMEKNPFVLGANLQ
GGEKLVSFPFDAARPHSETPAAPRPLDEDEDDEQPEVHETPDHAVFRWLAISYASAHLTM
TETFRGGCHAQDVTDAMGIVQGAKWRPRAGSMNDFSYLHTNCLELSIYLGCDKFPHESEL
QQEWENNKESLLTFMEQTHRGIKGLVTDQQGEPIANATIVVSGVKHSIRTASGGDYWRIL
NPGEYRVSARAEGYNPSTKTCSVFTTLLCTQCNTRTPRHQW
Download sequence
Identical sequences H9H0A7
ENSMGAP00000001155 ENSMGAP00000001155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]